Homologs in group_2252

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16940 FBDBKF_16940 85.7 Morganella morganii S1 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
EHELCC_16650 EHELCC_16650 85.7 Morganella morganii S2 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
NLDBIP_16860 NLDBIP_16860 85.7 Morganella morganii S4 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
LHKJJB_16610 LHKJJB_16610 85.7 Morganella morganii S3 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
HKOGLL_17575 HKOGLL_17575 85.7 Morganella morganii S5 ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
F4V73_RS18410 F4V73_RS18410 84.9 Morganella psychrotolerans ubiE bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

Distribution of the homologs in the orthogroup group_2252

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2252

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EWC9 0.0 521 100 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Proteus mirabilis (strain HI4320)
B1JP75 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FT0 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR39 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis (strain Pestoides F)
Q1CNB4 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R431 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Angola)
Q8D1I3 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis
B2K0Y4 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDE0 2.02e-159 445 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7MZ81 4.8e-159 444 83 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1CBG0 7.28e-159 443 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Antiqua)
A8G8B8 2.3e-158 442 82 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
A1JIF2 3.81e-158 441 81 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6DAQ7 3.94e-156 436 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DI77 1.3e-155 435 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MQL7 1.29e-153 430 80 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cronobacter sakazakii (strain ATCC BAA-894)
A8ACY2 4.54e-153 429 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0A2K5 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K6 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhi
B4TNX9 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella schwarzengrund (strain CVM19633)
B5BIX9 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain AKU_12601)
C0Q3E1 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi C (strain RKS4594)
A9MY97 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKP4 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ73 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella newport (strain SL254)
B4TBR3 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella heidelberg (strain SL476)
B5RFM8 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW73 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella enteritidis PT4 (strain P125109)
B5FNW6 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella dublin (strain CT_02021853)
Q57HN8 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella choleraesuis (strain SC-B67)
B5EZU8 7.43e-153 428 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella agona (strain SL483)
Q3YVD2 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella sonnei (strain Ss046)
P0A889 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri
Q0SZ25 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri serotype 5b (strain 8401)
Q32A11 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella dysenteriae serotype 1 (strain Sd197)
Q31UF3 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 4 (strain Sb227)
B2TVI4 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LU01 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LM21 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SMS-3-5 / SECEC)
B6I4H5 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SE11)
B7NFD6 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A887 2.02e-152 427 78 0 251 1 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12)
B1IW72 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6U0 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O9:H4 (strain HS)
B1XAJ7 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / DH10B)
C5A009 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / MC4100 / BW2952)
B7M638 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O8 (strain IAI1)
B7NV33 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YY82 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A888 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7
B7L996 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain 55989 / EAEC)
B7UNG3 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZU40 2.02e-152 427 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R477 4.64e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain UTI89 / UPEC)
Q8FBJ0 4.64e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAM1 4.64e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AI22 4.64e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O1:K1 / APEC
B7N2E1 4.64e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O81 (strain ED1a)
B7MHC0 4.64e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O45:K1 (strain S88 / ExPEC)
A9MIY3 7.11e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5XYI1 7.6e-152 426 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae (strain 342)
B2VG41 9.35e-152 425 79 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6TGL3 6.96e-151 423 78 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C3LPS5 8.42e-151 423 79 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 8.42e-151 423 79 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 8.42e-151 423 79 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MQ33 2.69e-149 419 79 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 2.69e-149 419 79 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
A4WFY5 3.12e-148 416 76 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Enterobacter sp. (strain 638)
A7MTX1 1.39e-146 412 76 0 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
Q87TH4 2.76e-146 412 76 0 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C5BCA4 4.57e-146 411 76 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Edwardsiella ictaluri (strain 93-146)
Q9CKD6 1.3e-145 410 75 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pasteurella multocida (strain Pm70)
P59911 7.13e-141 398 71 0 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6VTA1 3.53e-139 394 73 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Marinomonas sp. (strain MWYL1)
Q5QYG2 3.97e-138 391 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8G0S7 6.35e-137 388 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
Q0HZP7 6.78e-137 388 73 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-7)
Q0HEA1 6.78e-137 388 73 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-4)
A0L1M4 6.78e-137 388 73 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain ANA-3)
B1KR07 1.37e-136 387 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
A8H966 2.39e-136 386 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CI06 7.39e-136 385 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QIE1 9.21e-136 385 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TJ16 1.04e-135 385 70 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella halifaxensis (strain HAW-EB4)
A1SRS4 1.2e-135 385 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8E9R7 2.69e-135 384 72 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KYL8 7.63e-135 382 72 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS195)
A6WIE9 7.63e-135 382 72 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS185)
A3D9F2 7.63e-135 382 72 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6B6 1.75e-134 382 72 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS223)
A1SAJ8 3.86e-134 381 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12S23 4.4e-134 380 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1RP78 4.6e-134 380 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain W3-18-1)
A4Y2Q5 4.6e-134 380 71 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q3IJV7 1.49e-133 379 68 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudoalteromonas translucida (strain TAC 125)
Q9HUC0 4.9e-132 375 71 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EV4 4.9e-132 375 71 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3F6 4.9e-132 375 71 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain LESB58)
B0TZP1 1.58e-131 374 70 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q088H8 9.95e-131 372 69 0 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella frigidimarina (strain NCIMB 400)
A0Q549 1.89e-130 371 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. novicida (strain U112)
B2SFA2 4.5e-130 370 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. mediasiatica (strain FSC147)
C1DHS2 1.04e-129 370 70 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4IXH9 3.34e-129 368 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFE1 3.45e-129 368 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GU4 3.45e-129 368 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BNE2 4.79e-129 368 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain OSU18)
Q2A524 4.79e-129 368 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain LVS)
A7NAA1 4.79e-129 368 69 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4VGE5 4.35e-128 365 69 0 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stutzerimonas stutzeri (strain A1501)
C5BRL2 9.62e-128 364 71 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q88D17 1.22e-127 364 68 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA45 1.22e-127 364 68 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KM36 2.32e-127 364 68 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain GB-1)
B1J2S8 3.84e-127 363 67 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain W619)
Q1I3T0 4.78e-127 363 68 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas entomophila (strain L48)
Q9Z439 4.89e-127 363 68 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida
C3K8U4 5.17e-127 363 67 1 255 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain SBW25)
A6VDI6 7.92e-127 362 72 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
A4XPM7 1.11e-126 362 68 0 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas mendocina (strain ymp)
B3PH48 4.21e-126 360 69 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cellvibrio japonicus (strain Ueda107)
Q3KJC5 3.82e-125 358 67 1 255 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain Pf0-1)
Q4ZZG3 2.77e-124 356 67 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. syringae (strain B728a)
Q48PJ4 2.77e-124 356 67 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q21H69 6.21e-124 355 68 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q87UZ2 1.23e-123 354 67 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2SN12 4.96e-119 342 66 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Hahella chejuensis (strain KCTC 2396)
Q5X0X6 2.24e-114 331 62 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Paris)
Q5WSQ8 3.08e-114 330 62 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Lens)
A5II90 1.79e-113 328 62 0 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Corby)
Q491V7 2.7e-113 328 63 0 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Blochmanniella pennsylvanica (strain BPEN)
Q5ZRH9 3.2e-113 328 61 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q31IM5 4.7e-112 325 62 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A9N9F4 3.26e-110 320 58 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 331 / Henzerling II)
Q83A90 1.17e-109 319 58 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD75 1.17e-109 319 58 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain Dugway 5J108-111)
B6J3P6 1.17e-109 319 58 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuG_Q212)
Q7VRJ1 4.58e-109 317 59 0 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Blochmanniella floridana
Q7NZD3 1.45e-108 316 62 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B6J676 1.85e-108 316 58 0 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuK_Q154)
Q606J9 1.75e-107 313 60 0 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B2JCU8 1.26e-104 306 60 3 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C1DCV3 2.6e-104 305 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Laribacter hongkongensis (strain HLHK9)
A1KT06 3.31e-104 305 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q3SM81 8.64e-104 303 58 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Thiobacillus denitrificans (strain ATCC 25259)
Q2T139 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63XA0 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain K96243)
A3N5U8 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 668)
Q3JVZ6 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 1710b)
A3NRJ4 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 1106a)
A1V753 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain SAVP1)
Q62MP4 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain ATCC 23344)
A2S8L1 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain NCTC 10229)
A3MNT8 8.92e-104 303 60 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain NCTC 10247)
B4RK11 1.05e-103 303 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria gonorrhoeae (strain NCCP11945)
Q5F9R9 1.05e-103 303 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JV83 1.14e-103 303 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K075 1.99e-103 303 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q145P0 2.68e-102 300 59 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paraburkholderia xenovorans (strain LB400)
A9M3A0 3.45e-102 300 59 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Neisseria meningitidis serogroup C (strain 053442)
B2SX35 3.97e-102 299 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q39D13 5.27e-102 299 59 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BTN4 7.56e-102 299 59 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia orbicola (strain AU 1054)
A0KAF5 7.56e-102 299 59 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia cenocepacia (strain HI2424)
B2UFG8 1.11e-101 298 59 2 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ralstonia pickettii (strain 12J)
B1JYJ6 1.43e-101 298 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia orbicola (strain MC0-3)
B4EBC4 1.43e-101 298 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q0BBY4 1.83e-101 298 59 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YWF9 1.83e-101 298 59 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia ambifaria (strain MC40-6)
Q8Y278 1.96e-101 298 59 2 240 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7W0H1 2.48e-101 298 56 2 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3N6 2.48e-101 298 56 2 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF12 2.48e-101 298 56 2 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8P558 4.8e-101 297 59 0 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PPP2 5.53e-101 297 59 0 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas axonopodis pv. citri (strain 306)
A9AFC0 9.56e-101 296 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia multivorans (strain ATCC 17616 / 249)
A4JHS6 1.15e-100 296 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2Y6R0 1.31e-100 296 56 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q87DI1 2.37e-100 295 56 0 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA21 2.37e-100 295 56 0 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M23)
B0U6V1 4.66e-100 295 56 0 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M12)
Q1LRG9 7.07e-100 294 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q81ZZ8 1.01e-99 293 56 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2AH07 1.16e-99 293 58 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q2NYW4 2.08e-99 293 58 0 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9PD92 4.53e-99 292 55 1 253 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain 9a5c)
Q475X0 4.58e-99 291 57 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B4SJ34 7.33e-99 291 56 0 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stenotrophomonas maltophilia (strain R551-3)
Q0KEH6 1.92e-98 290 57 2 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q2KUG1 5.86e-98 289 56 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bordetella avium (strain 197N)
B2FUU6 4.51e-97 287 56 0 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stenotrophomonas maltophilia (strain K279a)
Q8D382 1.05e-94 281 48 0 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wigglesworthia glossinidia brevipalpis
A6WYI0 6.44e-89 266 54 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9MCZ2 6.1e-88 264 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YDE4 9.86e-88 264 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMK3 9.86e-88 264 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella melitensis biotype 2 (strain ATCC 23457)
Q576Q0 9.86e-88 264 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus biovar 1 (strain 9-941)
Q2YJM4 9.86e-88 264 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus (strain 2308)
B2SC50 9.86e-88 264 53 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella abortus (strain S19)
Q8FUZ3 3.34e-87 263 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella suis biovar 1 (strain 1330)
A9WW74 1.85e-86 261 52 1 243 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Brucella suis (strain ATCC 23445 / NCTC 10510)
Q1GC56 7.99e-85 256 50 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ruegeria sp. (strain TM1040)
A8LNK7 2.18e-84 254 49 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A5FZ96 1.41e-83 253 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Acidiphilium cryptum (strain JF-5)
A9ILA7 1.83e-83 253 49 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2KDB0 1.42e-82 250 50 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q66L51 3e-82 252 47 2 277 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Danio rerio
B5ZYK8 6.26e-82 249 49 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C3MCY6 8.13e-82 248 50 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6UFF7 3.87e-81 247 50 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Sinorhizobium medicae (strain WSM419)
Q16DL1 4.14e-81 246 48 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B3PZ92 7.44e-81 246 49 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium etli (strain CIAT 652)
Q6G1I2 8.29e-81 246 47 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella quintana (strain Toulouse)
Q1MME0 8.95e-81 246 48 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A1UUE1 1.09e-80 246 46 2 259 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q92SK7 5.01e-80 244 50 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium meliloti (strain 1021)
Q6G577 1.1e-79 243 47 1 242 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q98GV1 1.77e-79 243 48 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9Z5E9 2.93e-79 239 67 0 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) Pseudomonas oleovorans
Q13EN8 3.03e-79 242 48 1 252 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain BisB5)
B8IJ00 3.69e-79 241 49 2 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A4WVR7 9.33e-79 240 49 2 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q1RJY5 1.88e-78 239 46 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia bellii (strain RML369-C)
Q9VYF8 2.24e-78 241 45 2 259 2 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Drosophila melanogaster
Q8UIH5 4.32e-78 239 46 1 252 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4V7R3 5.94e-78 240 44 1 284 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Xenopus laevis
A8GXR2 8.63e-78 238 45 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia bellii (strain OSU 85-389)
B9J7S8 1.02e-77 238 47 1 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A8GPI0 1.75e-77 237 48 3 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia akari (strain Hartford)
A5E888 2.27e-77 237 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B9KQJ8 2.32e-77 237 47 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IY65 2.32e-77 237 47 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PFL1 2.32e-77 237 47 1 250 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B8GVY5 2.59e-77 237 45 2 253 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A258 2.59e-77 237 45 2 253 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q0P5A2 2.94e-77 239 44 3 286 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Bos taurus
Q2J2H9 3.4e-77 236 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain HaA2)
Q1QS47 3.59e-77 236 48 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B9JZF4 1.04e-76 235 47 1 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A4YJH0 1.4e-76 235 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bradyrhizobium sp. (strain ORS 278)
Q4UMW4 1.48e-76 234 47 3 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B0T7D0 1.53e-76 235 45 2 253 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Caulobacter sp. (strain K31)
Q54VN2 1.54e-76 237 45 5 275 3 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Dictyostelium discoideum
Q89WD0 2.39e-76 234 47 1 248 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1BAN1 2.67e-76 234 47 2 252 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paracoccus denitrificans (strain Pd 1222)
Q4G064 3.12e-76 236 45 4 286 2 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Rattus norvegicus
Q9CXI0 4.1e-76 236 45 5 286 1 Coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Mus musculus
B3Q619 4.44e-76 234 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain TIE-1)
Q6NDM2 4.44e-76 234 47 1 251 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9ZCP3 8.12e-76 233 44 3 247 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia prowazekii (strain Madrid E)
Q5HYK3 3.48e-75 234 46 4 277 1 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Homo sapiens
Q5RBK6 2.51e-74 232 45 5 286 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Pongo abelii
A8EZP4 3.71e-74 229 46 2 245 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia canadensis (strain McKiel)
Q68W57 6.69e-74 228 45 3 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia typhi (strain ATCC VR-144 / Wilmington)
C3PLF4 6.98e-74 228 46 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia africae (strain ESF-5)
Q92GT5 7.96e-74 228 46 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B4RC42 8.47e-74 228 46 2 249 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Phenylobacterium zucineum (strain HLK1)
A8GT99 8.5e-74 228 46 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia rickettsii (strain Sheila Smith)
B0BUT9 8.5e-74 228 46 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia rickettsii (strain Iowa)
A8F2G9 8.68e-74 228 46 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia massiliae (strain Mtu5)
Q5ZLL5 1.63e-72 226 44 1 277 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Gallus gallus
C4K2K3 3.56e-72 223 45 2 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rickettsia peacockii (strain Rustic)
P34666 2.61e-71 223 46 4 245 3 coq-5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Caenorhabditis elegans
Q9X3X2 1.78e-68 214 45 3 244 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C0R2Q3 2.4e-68 213 45 4 239 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73HZ4 3.6e-67 210 45 4 239 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wolbachia pipientis wMel
Q5JNC0 1.21e-66 211 41 3 261 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Oryza sativa subsp. japonica
Q9LVC8 4.23e-65 207 40 2 261 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Arabidopsis thaliana
P55905 3.29e-64 204 45 4 240 2 None 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Leishmania donovani
Q9JPD1 4.26e-63 201 41 3 246 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rubrivivax gelatinosus (strain NBRC 100245 / IL144)
P87230 9.53e-63 201 43 6 264 3 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9XAP8 5.37e-62 197 42 3 226 3 menG Demethylmenaquinone methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q81ZX2 5.32e-61 194 41 3 232 3 menG Demethylmenaquinone methyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B2HRQ2 6.06e-60 192 43 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q1BE01 6.2e-60 192 43 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain MCS)
A1UAY5 6.2e-60 192 43 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain KMS)
C4LL93 6.42e-60 192 43 2 232 3 menG Demethylmenaquinone methyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
O66128 2.14e-59 191 37 1 237 3 menG Demethylmenaquinone methyltransferase Micrococcus luteus
A0PLV5 2.16e-59 190 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium ulcerans (strain Agy99)
A3PUJ1 2.33e-59 190 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain JLS)
Q2YY85 2.83e-59 190 40 1 235 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P67063 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MW2)
A8Z450 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G992 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MSSA476)
P67062 3.02e-59 190 40 1 234 1 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain N315)
P67061 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH20 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Newman)
Q5HFV2 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain COL)
A5ISZ9 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH9)
A6U1T9 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH1)
A7X2H6 3.02e-59 190 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A9WRT1 4.18e-59 190 42 3 233 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B1MHC3 1.05e-58 188 43 3 232 3 menG Demethylmenaquinone methyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
P9WFR3 2.75e-58 187 42 3 236 1 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR2 2.75e-58 187 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZT8 2.75e-58 187 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKN8 2.75e-58 187 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KG35 2.75e-58 187 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A639 2.75e-58 187 42 3 236 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6GGU0 3.87e-58 187 40 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MRSA252)
P67055 7.25e-58 187 39 1 232 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 7.25e-58 187 39 1 232 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 7.25e-58 187 39 1 232 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 7.25e-58 187 39 1 232 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A1SE26 7.78e-58 186 40 2 232 3 menG Demethylmenaquinone methyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q4L6H3 8.77e-58 186 37 1 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q8CSH9 9.02e-58 186 37 1 235 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 9.02e-58 186 37 1 235 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C5C0T0 1.52e-57 186 41 3 236 3 menG Demethylmenaquinone methyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A1R990 2.22e-57 186 40 2 232 3 menG Demethylmenaquinone methyltransferase Paenarthrobacter aurescens (strain TC1)
A0AK43 2.53e-57 185 38 1 232 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5YPB0 2.72e-57 185 40 2 233 3 menG Demethylmenaquinone methyltransferase Nocardia farcinica (strain IFM 10152)
B8DBZ5 2.72e-57 185 39 1 232 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
P49017 5.98e-57 187 42 6 263 1 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B9DNV5 7.39e-57 184 38 2 234 3 menG Demethylmenaquinone methyltransferase Staphylococcus carnosus (strain TM300)
B0RCZ0 1.65e-56 183 41 2 234 3 menG Demethylmenaquinone methyltransferase Clavibacter sepedonicus
A1T3S1 4.56e-56 182 41 3 236 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q73SL8 5e-56 182 41 3 235 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q49XS5 5.13e-56 182 36 1 235 3 menG Demethylmenaquinone methyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1W525 1.78e-55 180 40 4 232 3 menG Demethylmenaquinone methyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B7GHP8 6.01e-55 179 38 1 233 3 menG Demethylmenaquinone methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B5EFL1 9.84e-55 179 38 1 231 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E4U6 1.13e-54 178 38 1 231 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sp. (strain M21)
Q9CBA8 3.21e-54 177 41 3 235 3 menG Demethylmenaquinone methyltransferase Mycobacterium leprae (strain TN)
P31113 4.76e-54 177 37 1 233 1 menG Demethylmenaquinone methyltransferase Bacillus subtilis (strain 168)
Q72HI4 7.42e-54 176 42 3 221 3 menG Demethylmenaquinone methyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A4T183 1.49e-53 175 42 2 226 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
Q8CWG0 1.9e-53 175 38 1 230 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q74EU2 1.93e-53 176 37 1 231 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5WGT4 1.93e-53 175 39 1 230 3 menG Demethylmenaquinone methyltransferase Shouchella clausii (strain KSM-K16)
Q5KXU0 2.57e-53 175 38 1 230 3 menG Demethylmenaquinone methyltransferase Geobacillus kaustophilus (strain HTA426)
P94298 3.58e-53 174 37 1 230 3 menG Demethylmenaquinone methyltransferase Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
P59912 1.37e-52 175 36 3 240 3 menG Demethylmenaquinone methyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A7GN50 1.41e-52 173 37 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q3A209 2.88e-52 172 41 3 224 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A0QRH1 3.11e-52 172 41 2 226 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B1HTA6 5.38e-52 171 37 1 230 3 menG Demethylmenaquinone methyltransferase Lysinibacillus sphaericus (strain C3-41)
B9LZA9 6.59e-52 171 34 2 238 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C3PKL1 9.08e-52 171 39 2 235 3 menG Demethylmenaquinone methyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A7Z627 2.65e-51 170 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O86169 3.04e-51 169 36 1 233 3 menG Demethylmenaquinone methyltransferase Geobacillus stearothermophilus
A6L3D5 3.3e-51 170 35 2 235 3 menG Demethylmenaquinone methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A5GA37 4.62e-51 169 35 2 238 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea uraniireducens (strain Rf4)
Q65I24 9.32e-51 168 36 1 230 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8A005 9.73e-51 169 35 2 235 3 menG Demethylmenaquinone methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
C5D3E5 1.03e-50 168 36 1 230 3 menG Demethylmenaquinone methyltransferase Geobacillus sp. (strain WCH70)
Q88SI6 1.09e-50 168 36 0 226 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q73AY2 1.54e-50 168 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6MHQ3 3.24e-50 167 36 3 226 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q6HL42 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63DL9 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain ZK / E33L)
B9IVN5 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain Q1)
B7HL23 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain AH187)
C1EN10 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain 03BB102)
B7JGZ8 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain AH820)
Q81SW0 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus anthracis
C3L8S6 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5A0 3.39e-50 167 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus anthracis (strain A0248)
Q9KCC4 5.73e-50 167 36 1 232 3 menG Demethylmenaquinone methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q47LE2 5.78e-50 166 38 5 236 3 menG Demethylmenaquinone methyltransferase Thermobifida fusca (strain YX)
Q81FQ6 6.02e-50 166 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HHR7 6.02e-50 166 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain B4264)
B7IP91 6.02e-50 166 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus cereus (strain G9842)
A9VMC2 1.49e-49 165 36 1 233 3 menG Demethylmenaquinone methyltransferase Bacillus mycoides (strain KBAB4)
A8FEK9 2.25e-49 165 36 1 234 3 menG Demethylmenaquinone methyltransferase Bacillus pumilus (strain SAFR-032)
Q64XV8 9.69e-49 164 34 1 231 3 menG Demethylmenaquinone methyltransferase Bacteroides fragilis (strain YCH46)
Q5LH04 9.69e-49 164 34 1 231 3 menG Demethylmenaquinone methyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A4QBE5 1.37e-48 162 36 2 235 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain R)
Q7MVR7 2.11e-48 162 33 0 230 3 menG Demethylmenaquinone methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RJE9 2.18e-48 162 33 0 230 3 menG Demethylmenaquinone methyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8NT39 4.75e-48 161 36 2 235 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B1VEN4 5.01e-48 161 39 4 237 3 menG Demethylmenaquinone methyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q9RRT0 6.72e-48 161 36 3 234 3 menG Demethylmenaquinone methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8FSB3 3.3e-46 157 39 3 236 3 menG Demethylmenaquinone methyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P49016 4.59e-46 157 36 1 222 3 menG Demethylmenaquinone methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q24W96 5.91e-46 157 32 0 231 3 menG Demethylmenaquinone methyltransferase Desulfitobacterium hafniense (strain Y51)
Q8DGE4 1.02e-43 150 36 4 229 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q67LE6 6.02e-43 149 34 1 244 3 menG Demethylmenaquinone methyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q74LY0 2.52e-42 147 35 3 227 3 menG Demethylmenaquinone methyltransferase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8LCA4 3.21e-41 144 35 2 246 3 menG Demethylmenaquinone methyltransferase Parafrankia sp. (strain EAN1pec)
Q8EXJ3 2.18e-40 142 35 5 243 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FL1 2.18e-40 142 35 5 243 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A7NF26 2.64e-40 142 34 2 233 3 menG Demethylmenaquinone methyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5UVB2 5.53e-40 141 34 4 234 3 menG Demethylmenaquinone methyltransferase Roseiflexus sp. (strain RS-1)
P67064 7.05e-40 140 37 6 229 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 7.05e-40 140 37 6 229 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
Q3ED65 9.68e-39 138 32 3 234 1 MENG 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic Arabidopsis thaliana
Q5N4X9 9.37e-38 135 32 2 222 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31P90 9.37e-38 135 32 2 222 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q6ANL3 4.96e-37 133 33 2 226 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8YLP4 1.32e-35 129 29 2 227 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8KF69 1.99e-35 129 31 5 245 3 menG Demethylmenaquinone methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3QLI9 1.25e-34 127 31 5 241 3 menG Demethylmenaquinone methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3MD91 1.61e-34 126 29 2 227 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q6MCB5 3.54e-34 126 31 3 238 3 menG Demethylmenaquinone methyltransferase Protochlamydia amoebophila (strain UWE25)
Q9K2B6 4.09e-34 125 31 5 210 3 menG Demethylmenaquinone methyltransferase Chlamydia pneumoniae
B2IUM7 3.49e-33 123 29 3 229 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A8FKB3 3.31e-31 118 31 5 234 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9WZL2 9.8e-31 117 34 7 234 3 menG Demethylmenaquinone methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P72818 1.23e-30 117 30 3 226 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HWE7 3.79e-29 112 30 5 234 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni (strain RM1221)
A1VY43 3.79e-29 112 30 5 234 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PJW4 5.23e-29 112 29 4 207 3 menG Demethylmenaquinone methyltransferase Chlamydia muridarum (strain MoPn / Nigg)
Q9PIH5 9.02e-29 112 29 5 234 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B0BC65 9.11e-28 109 29 6 226 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B800 9.11e-28 109 29 6 226 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84435 3.56e-27 107 29 6 226 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KLS2 3.56e-27 107 29 6 226 3 menG Demethylmenaquinone methyltransferase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q81ZV1 7.39e-27 106 28 5 211 3 menG Demethylmenaquinone methyltransferase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q253I8 1.7e-24 100 27 5 211 3 menG Demethylmenaquinone methyltransferase Chlamydia felis (strain Fe/C-56)
O31474 3.01e-15 76 36 3 125 1 ycgJ Uncharacterized methyltransferase YcgJ Bacillus subtilis (strain 168)
P64842 3.52e-11 65 28 2 117 3 BQ2027_MB1440C Uncharacterized protein Mb1440c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY7 3.52e-11 65 28 2 117 1 Rv1405c Uncharacterized protein Rv1405c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY6 3.52e-11 65 28 2 117 3 MT1449 Uncharacterized protein MT1449 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6N3Y0 3.72e-11 65 37 1 105 1 arsM Arsenite methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P46326 2.54e-10 62 27 1 112 3 yxbB Uncharacterized protein YxbB Bacillus subtilis (strain 168)
O13871 2.79e-10 62 32 2 115 3 SPAC1B3.06c Uncharacterized methyltransferase C1B3.06c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
C5BMZ8 3.33e-10 63 23 7 226 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
P54458 3.76e-10 62 31 6 144 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
Q8TJK1 3.99e-10 62 37 1 102 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P20187 4.16e-10 62 27 4 175 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
Q4WQZ0 4.47e-09 59 22 9 235 2 tpcH Methyltransferase tpcH Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8KZ94 6.96e-09 58 28 2 128 1 rebM Demethylrebeccamycin-D-glucose O-methyltransferase Lentzea aerocolonigenes
L0E172 2.06e-08 57 28 1 119 3 phqN Methyltransferase phqN Penicillium fellutanum
Q55423 2.21e-08 56 27 5 158 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0A0D3MJQ5 5.96e-08 55 30 6 169 1 arsM Arsenite methyltransferase Clostridium sp.
A6W0X8 6.55e-08 55 25 3 159 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Marinomonas sp. (strain MWYL1)
P30866 1e-07 54 40 0 59 3 yafE Uncharacterized protein YafE Escherichia coli (strain K12)
E3G327 1.08e-07 54 31 5 128 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
Q05197 1.42e-07 53 28 1 125 4 pmtA Phosphatidylethanolamine N-methyltransferase Cereibacter sphaeroides
P65349 1.5e-07 54 37 3 102 3 BQ2027_MB3374 Uncharacterized methyltransferase Mb3374 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK01 1.5e-07 54 37 3 102 1 Rv3342 Uncharacterized methyltransferase Rv3342 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK00 1.5e-07 54 37 3 102 3 MT3445 Uncharacterized methyltransferase MT3445 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P36571 2.23e-07 53 30 4 124 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Serratia marcescens
Q9TYP1 2.35e-07 54 27 4 148 1 strm-1 Sterol 4-C-methyltransferase strm-1 Caenorhabditis elegans
C3N8G6 2.6e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MTW8 2.6e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MJI5 2.6e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KJM8 2.6e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N0H8 2.6e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.16.27)
C3NJQ5 2.8e-07 53 26 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
H2E7T8 3.04e-07 54 23 6 195 2 SMT-1 Sterol methyltransferase-like 1 Botryococcus braunii
Q9LM02 4.48e-07 53 26 1 113 1 SMT1 Cycloartenol-C-24-methyltransferase Arabidopsis thaliana
Q57060 8.48e-07 52 29 2 117 4 HI_0095 Uncharacterized protein HI_0095 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D8MPW4 8.64e-07 52 25 5 172 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
Q6ZIX2 9.94e-07 52 29 2 116 2 Smt1-1 Cycloartenol-C-24-methyltransferase 1 Oryza sativa subsp. japonica
B3PI89 1.01e-06 52 28 6 157 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
Q9FR44 1.11e-06 52 25 4 152 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
A1WVM4 1.25e-06 52 28 5 170 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
P64840 1.33e-06 51 26 3 118 3 BQ2027_MB1438C Uncharacterized protein Mb1438c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY9 1.33e-06 51 26 3 118 3 Rv1403c Uncharacterized protein Rv1403c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY8 1.33e-06 51 26 3 118 3 MT1447 Uncharacterized protein MT1447 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6C2D9 1.34e-06 52 28 1 112 3 ERG6 Sterol 24-C-methyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
G0FUS0 1.51e-06 51 27 1 111 1 RAM_03320 27-O-demethylrifamycin SV methyltransferase Amycolatopsis mediterranei (strain S699)
Q944H0 1.63e-06 52 25 3 143 1 NMT2 Phosphoethanolamine N-methyltransferase 2 Arabidopsis thaliana
Q4W9V1 1.79e-06 51 25 1 120 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q7CH67 2.09e-06 51 27 4 118 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Yersinia pestis
A0A1D6NER6 2.09e-06 51 26 3 150 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
A6UYW3 2.14e-06 51 29 3 122 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q4X158 2.35e-06 51 26 3 119 1 tmtA Gliotoxin thiomethyltransferase GtmA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P96576 2.4e-06 50 23 3 118 3 ydaC Uncharacterized methyltransferase YdaC Bacillus subtilis (strain 168)
O06898 2.65e-06 50 28 3 126 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudescherichia vulneris
Q8EDK8 3.52e-06 50 35 2 98 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
D2T333 4.67e-06 50 30 3 120 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
Q91WU5 5.01e-06 50 30 3 111 1 As3mt Arsenite methyltransferase Mus musculus
A0A0A2IBN3 5.04e-06 50 28 4 146 1 cnsE O-methyltransferase cnsE Penicillium expansum
Q96WX4 5.76e-06 50 24 1 120 1 erg6 Sterol 24-C-methyltransferase Pneumocystis carinii (strain B80)
A1CLY8 5.83e-06 50 27 4 145 3 ccsA Polyketide synthase-nonribosomal peptide synthetase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
A0A075D5I4 5.91e-06 50 22 2 153 1 PiNMT Picrinine-N-methytransferase Rauvolfia serpentina
Q759S7 6.68e-06 50 28 2 129 3 ERG6 Sterol 24-C-methyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q9M571 8.35e-06 50 27 2 118 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
A4SM99 8.41e-06 49 28 7 156 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aeromonas salmonicida (strain A449)
Q97A64 9.88e-06 48 31 2 109 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q54I98 1.19e-05 49 24 3 153 1 smt1 Probable cycloartenol-C-24-methyltransferase 1 Dictyostelium discoideum
A8GGX8 1.27e-05 48 28 8 159 3 ubiG Ubiquinone biosynthesis O-methyltransferase Serratia proteamaculans (strain 568)
Q0AA73 1.68e-05 48 25 6 191 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
U2ZU49 1.7e-05 48 32 2 107 1 arsM Arsenite methyltransferase Pseudomonas alcaligenes (strain ATCC 14909 / DSM 50342 / JCM 20561 / NBRC 14159 / NCIMB 9945 / NCTC 10367 / 1577)
Q97WC7 2.37e-05 47 25 3 127 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A0A8X8M4W6 2.61e-05 48 25 3 139 2 TMT3 Gamma-tocopherol methyltransferase, chloroplastic Catharanthus roseus
A6TBT7 2.65e-05 47 30 7 145 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q55214 2.89e-05 47 26 4 168 1 dauC Aklanonic acid methyltransferase DauC Streptomyces sp. (strain C5)
Q609G2 2.93e-05 47 25 7 188 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q609U9 3.21e-05 47 32 5 126 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5GZB5 3.32e-05 47 29 5 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 3.32e-05 47 29 5 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 3.32e-05 47 29 5 132 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A0A3G1DJF3 4.2e-05 48 27 6 150 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
Q50LG3 4.31e-05 48 28 4 132 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
Q4K8M4 4.41e-05 47 29 6 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C8YTM5 4.76e-05 47 25 4 147 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
Q3K8T6 4.84e-05 47 29 7 138 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q8VHT6 5.02e-05 47 28 2 111 1 As3mt Arsenite methyltransferase Rattus norvegicus
D7UQ44 5.09e-05 47 27 4 122 1 sol1 Prosolanapyrone synthase Alternaria solani
B5XNZ3 6.87e-05 46 29 7 145 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
Q9KJ20 7.32e-05 47 25 2 116 1 None Glycine/sarcosine/dimethylglycine N-methyltransferase Actinopolyspora halophila
Q56308 7.84e-05 46 29 3 133 1 pcm Protein-L-isoaspartate O-methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9C6B9 7.91e-05 47 25 4 143 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
Q0WPT7 7.98e-05 46 24 6 162 1 At2g41040 Uncharacterized methyltransferase At2g41040, chloroplastic Arabidopsis thaliana
C3K6J1 8.33e-05 46 28 6 135 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17575
Feature type CDS
Gene ubiE
Product bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
Location 3858276 - 3859031 (strand: 1)
Length 756 (nucleotides) / 251 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2252
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01209 ubiE/COQ5 methyltransferase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Kegg Ortholog Annotation(s)

Protein Sequence

MTQQSKETTDFGFQTVDKDEKQTMVAKVFHSVASKYDLMNDLMSFGIHRVWKRYTIEASGVRRNQRVLDLAGGTGDLTAKFSRLVGENGEVVLADINDSMLKMGREKLRDHGIVGNVSYVQANAEELPFPDDYFDCITISFGLRNVTDKAKALRSMFRVLKPGGRLLVLEFSKPVLDPLSKIYDAYSFHILPRIGQVIVNDADSYRYLTESIRMHPDQETLKGMMEEAGFDQVSYTNMTGGIVALHKGFKF

Flanking regions ( +/- flanking 50bp)

AAGAAATGTACTGAATTTACTAAATTTTGATTAATTAGCGGGCAAATAATATGACTCAACAATCTAAGGAAACAACAGATTTTGGTTTCCAAACCGTTGACAAAGATGAAAAACAAACCATGGTGGCCAAGGTTTTTCACTCTGTTGCATCTAAATACGATTTAATGAATGACTTAATGTCTTTTGGCATCCATCGTGTCTGGAAACGCTATACCATTGAGGCAAGTGGTGTAAGACGTAATCAACGTGTACTTGACTTGGCAGGTGGAACCGGCGATTTAACGGCAAAATTCTCTCGTTTAGTAGGAGAGAATGGTGAAGTGGTTTTAGCTGATATCAATGACTCCATGTTAAAAATGGGACGTGAGAAACTGCGTGATCACGGTATTGTTGGTAATGTCAGTTATGTACAAGCGAATGCAGAAGAGCTGCCATTCCCTGATGATTACTTTGACTGTATCACTATCTCGTTCGGTTTACGTAATGTGACTGATAAAGCCAAAGCGTTACGTTCTATGTTCCGTGTGCTAAAACCCGGTGGACGTCTATTAGTCCTTGAATTCTCTAAACCCGTTCTTGATCCGCTAAGTAAGATTTATGATGCTTACTCTTTCCATATATTACCAAGAATTGGTCAAGTGATTGTGAATGATGCAGATAGCTATCGCTATTTAACAGAATCTATTCGCATGCACCCAGACCAAGAAACATTAAAAGGAATGATGGAAGAAGCTGGGTTTGATCAGGTTTCCTATACCAATATGACTGGAGGTATAGTTGCATTACACAAAGGGTTTAAATTCTAAGATGGAAAAAGCCACTTTTTCTCATGATATTGCTTCTCAAGTGCTCTATC