Homologs in group_281

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06190 FBDBKF_06190 34.8 Morganella morganii S1 thyA thymidylate synthase
EHELCC_09235 EHELCC_09235 34.8 Morganella morganii S2 thyA thymidylate synthase
NLDBIP_09615 NLDBIP_09615 34.8 Morganella morganii S4 thyA thymidylate synthase
LHKJJB_08140 LHKJJB_08140 34.8 Morganella morganii S3 thyA thymidylate synthase
HKOGLL_07690 HKOGLL_07690 34.8 Morganella morganii S5 thyA thymidylate synthase
F4V73_RS17895 F4V73_RS17895 43.9 Morganella psychrotolerans - thymidylate synthase
PMI_RS11465 PMI_RS11465 36.9 Proteus mirabilis HI4320 - thymidylate synthase

Distribution of the homologs in the orthogroup group_281

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_281

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8U4 0.0 508 90 0 264 3 thyA Thymidylate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JPC9 0.0 507 89 0 264 3 thyA Thymidylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q667F9 0.0 506 88 0 264 3 thyA Thymidylate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FFE0 0.0 506 88 0 264 3 thyA Thymidylate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WE03 0.0 506 89 0 264 3 thyA Thymidylate synthase Enterobacter sp. (strain 638)
A8GIH7 0.0 505 88 0 264 3 thyA Thymidylate synthase Serratia proteamaculans (strain 568)
A8AP42 0.0 505 89 0 264 3 thyA Thymidylate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8ZMA9 0.0 503 89 0 264 3 thyA Thymidylate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N2L7 0.0 503 89 0 264 3 thyA Thymidylate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEN6 0.0 503 89 0 264 3 thyA Thymidylate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57KB6 0.0 503 89 0 264 3 thyA Thymidylate synthase Salmonella choleraesuis (strain SC-B67)
A4TLC5 0.0 503 87 0 264 3 thyA Thymidylate synthase Yersinia pestis (strain Pestoides F)
Q1CFB5 0.0 503 87 0 264 3 thyA Thymidylate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZHV1 0.0 503 87 0 264 3 thyA Thymidylate synthase Yersinia pestis
Q1CAR9 0.0 503 87 0 264 3 thyA Thymidylate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q3YY33 0.0 501 89 0 264 3 thyA Thymidylate synthase Shigella sonnei (strain Ss046)
B7LNI2 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R7I6 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli (strain UTI89 / UPEC)
B7N759 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A884 0.0 501 89 0 264 1 thyA Thymidylate synthase Escherichia coli (strain K12)
P0A885 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TE05 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AF39 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O1:K1 / APEC
C4ZZX9 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LY83 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O8 (strain IAI1)
B7MZC6 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O81 (strain ED1a)
B7NVX2 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A886 0.0 501 89 0 264 1 thyA Thymidylate synthase Escherichia coli O157:H7
B7LF04 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli (strain 55989 / EAEC)
B7MLH3 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHP4 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQT3 0.0 501 89 0 264 3 thyA Thymidylate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
C0PXI9 0.0 501 89 0 264 3 thyA Thymidylate synthase Salmonella paratyphi C (strain RKS4594)
P48464 0.0 501 89 0 264 2 thyA Thymidylate synthase Shigella flexneri
Q0T137 0.0 501 89 0 264 3 thyA Thymidylate synthase Shigella flexneri serotype 5b (strain 8401)
B1IU17 0.0 500 89 0 264 3 thyA Thymidylate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3W0 0.0 500 89 0 264 3 thyA Thymidylate synthase Escherichia coli O9:H4 (strain HS)
Q8Z412 1.95e-180 499 89 0 264 3 thyA Thymidylate synthase Salmonella typhi
A9MS82 2.18e-180 499 88 0 264 3 thyA Thymidylate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q31XG0 2.2e-180 499 89 0 264 3 thyA Thymidylate synthase Shigella boydii serotype 4 (strain Sb227)
Q32C94 2.46e-180 499 88 0 264 3 thyA Thymidylate synthase Shigella dysenteriae serotype 1 (strain Sd197)
A6TDG3 4.03e-179 496 87 0 264 3 thyA Thymidylate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6D8I6 1.18e-178 494 85 0 264 3 thyA Thymidylate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6REU8 3.38e-178 493 86 0 264 3 thyA Thymidylate synthase Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
C6DAE9 8.32e-177 490 85 0 264 3 thyA Thymidylate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MR31 2.72e-174 483 84 0 264 3 thyA Thymidylate synthase Cronobacter sakazakii (strain ATCC BAA-894)
C5BH86 4.04e-174 483 83 0 264 3 thyA Thymidylate synthase Edwardsiella ictaluri (strain 93-146)
A0KG32 4.32e-172 478 82 0 264 3 thyA Thymidylate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SIW7 2.61e-170 473 82 0 264 3 thyA Thymidylate synthase Aeromonas salmonicida (strain A449)
Q2NRH3 1.22e-163 456 78 0 264 3 thyA Thymidylate synthase Sodalis glossinidius (strain morsitans)
C4K7G3 4.22e-161 450 75 0 264 3 thyA Thymidylate synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q8EH94 4.08e-160 447 77 0 264 3 thyA Thymidylate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HSH8 6.33e-160 447 77 0 264 3 thyA Thymidylate synthase Shewanella sp. (strain MR-7)
Q0HG85 6.33e-160 447 77 0 264 3 thyA Thymidylate synthase Shewanella sp. (strain MR-4)
A1S3W8 3.35e-159 445 77 0 264 3 thyA Thymidylate synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KZP5 4.51e-159 445 77 0 264 3 thyA Thymidylate synthase Shewanella sp. (strain ANA-3)
A3D1U3 1.16e-156 439 75 0 264 3 thyA Thymidylate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBR5 1.71e-156 438 75 0 264 3 thyA Thymidylate synthase Shewanella baltica (strain OS223)
A9L5M3 6.46e-156 437 75 0 264 3 thyA Thymidylate synthase Shewanella baltica (strain OS195)
A6WKP4 6.46e-156 437 75 0 264 3 thyA Thymidylate synthase Shewanella baltica (strain OS185)
A1RME0 1.81e-155 436 75 0 264 3 thyA Thymidylate synthase Shewanella sp. (strain W3-18-1)
A4Y4J1 1.81e-155 436 75 0 264 3 thyA Thymidylate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q12KG8 2.33e-155 436 75 0 264 3 thyA Thymidylate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1LSU0 6.73e-153 429 73 0 264 3 thyA Thymidylate synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q1LK81 1.88e-149 421 71 0 264 3 thyA Thymidylate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A5II41 4.14e-149 420 70 0 264 3 thyA Thymidylate synthase Legionella pneumophila (strain Corby)
Q5ZRL3 4.67e-149 419 70 0 264 3 thyA Thymidylate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X119 4.93e-149 419 70 0 264 3 thyA Thymidylate synthase Legionella pneumophila (strain Paris)
Q5WSU5 7e-149 419 70 0 264 3 thyA Thymidylate synthase Legionella pneumophila (strain Lens)
Q5KZ25 1.46e-148 418 70 0 264 3 thyA Thymidylate synthase Geobacillus kaustophilus (strain HTA426)
C5DAR2 4.92e-148 417 70 0 264 3 thyA Thymidylate synthase Geobacillus sp. (strain WCH70)
A4INY1 1.92e-147 416 68 0 264 3 thyA Thymidylate synthase Geobacillus thermodenitrificans (strain NG80-2)
Q2SA17 8.05e-147 414 70 0 264 3 thyA Thymidylate synthase Hahella chejuensis (strain KCTC 2396)
A4SVT7 6.29e-144 407 70 0 264 3 thyA Thymidylate synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q83BG2 5.88e-143 404 66 0 264 3 thyA Thymidylate synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N980 5.88e-143 404 66 0 264 3 thyA Thymidylate synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KF61 5.88e-143 404 66 0 264 3 thyA Thymidylate synthase Coxiella burnetii (strain Dugway 5J108-111)
Q11VK5 7.01e-143 404 69 0 264 3 thyA Thymidylate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8K9C3 3.96e-142 402 65 0 264 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C1D070 5.09e-142 402 68 0 264 3 thyA Thymidylate synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B7GI39 9.82e-142 401 68 0 264 3 thyA Thymidylate synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q8Y0U6 1.26e-141 401 69 0 264 3 thyA Thymidylate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0K889 1.94e-141 400 68 0 264 3 thyA Thymidylate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B7KQG2 4.21e-140 397 67 0 264 3 thyA Thymidylate synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q6MID2 4.7e-140 397 68 0 264 3 thyA Thymidylate synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q3SH96 6.74e-140 396 68 0 264 3 thyA Thymidylate synthase Thiobacillus denitrificans (strain ATCC 25259)
A4Y044 2.15e-139 395 67 0 264 3 thyA Thymidylate synthase Pseudomonas mendocina (strain ymp)
Q5F732 2.32e-139 395 69 0 264 3 thyA Thymidylate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KVB3 2.43e-139 395 69 0 264 3 thyA Thymidylate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1W5A4 2.65e-139 395 67 1 269 3 thyA Thymidylate synthase Acidovorax sp. (strain JS42)
Q9JY72 3.85e-139 394 69 0 264 3 thyA Thymidylate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JT57 6.3e-139 394 69 0 264 3 thyA Thymidylate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q82WU3 7.1e-139 394 67 0 264 3 thyA Thymidylate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A2SHH0 1.18e-138 394 67 1 270 3 thyA Thymidylate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A5CWK3 6.64e-138 391 67 0 264 3 thyA Thymidylate synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q9K7B5 7.82e-138 391 66 0 264 3 thyA Thymidylate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O33380 9.87e-138 391 69 1 265 3 thyA Thymidylate synthase Neisseria gonorrhoeae
A4VGL9 1.21e-137 390 66 0 264 3 thyA Thymidylate synthase Stutzerimonas stutzeri (strain A1501)
Q31I55 1.58e-137 391 64 1 277 3 thyA Thymidylate synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P57515 2.14e-137 390 63 0 264 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9L8 2.36e-137 390 63 0 264 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7X0 2.94e-137 390 63 0 264 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q1QUD9 3.32e-137 390 67 0 264 3 thyA Thymidylate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5P233 3.59e-137 389 68 0 264 3 thyA Thymidylate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
C4L1C9 5.04e-137 389 67 0 264 3 thyA Thymidylate synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A1AWQ8 6.27e-137 389 67 0 264 3 thyA Thymidylate synthase Ruthia magnifica subsp. Calyptogena magnifica
Q0SEI1 9.55e-137 389 68 1 261 3 thyA Thymidylate synthase Rhodococcus jostii (strain RHA1)
Q8PP46 2.02e-136 387 67 0 264 3 thyA Thymidylate synthase Xanthomonas axonopodis pv. citri (strain 306)
Q5GWB5 3.1e-136 387 67 0 264 3 thyA Thymidylate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZH9 3.1e-136 387 67 0 264 3 thyA Thymidylate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BX87 9.27e-136 386 67 0 264 3 thyA Thymidylate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0ABR1 9.9e-136 386 65 0 264 3 thyA Thymidylate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5WDS1 1.02e-135 386 64 0 264 3 thyA Thymidylate synthase Shouchella clausii (strain KSM-K16)
Q7NZ95 1.44e-135 385 66 0 264 3 thyA Thymidylate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9I6F1 1.49e-135 385 65 0 264 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02U73 1.49e-135 385 65 0 264 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V2Q5 1.49e-135 385 65 0 264 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain LESB58)
Q5YPL7 2.39e-135 385 66 1 263 3 thyA Thymidylate synthase Nocardia farcinica (strain IFM 10152)
C0ZI91 2.57e-135 385 66 0 264 3 thyA Thymidylate synthase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q8PCE7 2.6e-135 385 67 0 264 3 thyA Thymidylate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UR35 2.6e-135 385 67 0 264 3 thyA Thymidylate synthase Xanthomonas campestris pv. campestris (strain 8004)
B8GN06 3.68e-135 385 65 1 277 3 thyA Thymidylate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q89G35 4.79e-135 384 66 0 264 3 thyA Thymidylate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C1DK16 9.56e-135 383 66 0 264 3 thyA Thymidylate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q134B1 1.2e-134 383 65 0 264 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain BisB5)
A6UYE6 1.42e-134 383 65 0 264 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain PA7)
B8IF20 4.19e-134 382 64 0 264 3 thyA Thymidylate synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q9RAM7 4.33e-134 382 65 0 264 3 thyA1 Thymidylate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A6LIC2 4.94e-134 382 65 0 264 3 thyA Thymidylate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A7HVX4 5.76e-134 381 65 0 264 3 thyA Thymidylate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A0QVR9 5.79e-134 381 65 1 261 3 thyA Thymidylate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1U3D8 6.52e-134 382 65 2 279 3 thyA Thymidylate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1KAF7 7.57e-134 381 65 0 264 3 thyA Thymidylate synthase Azoarcus sp. (strain BH72)
A1TM53 9.88e-134 381 65 1 270 3 thyA Thymidylate synthase Paracidovorax citrulli (strain AAC00-1)
Q21U56 1.44e-133 381 65 1 270 3 thyA Thymidylate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6AFI0 3.88e-133 379 65 0 261 3 thyA Thymidylate synthase Leifsonia xyli subsp. xyli (strain CTCB07)
A6WGF9 5.8e-133 379 65 1 262 3 thyA Thymidylate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
C1D4I5 1.28e-132 378 67 0 264 3 thyA Thymidylate synthase Laribacter hongkongensis (strain HLHK9)
A7Z5T3 1.28e-132 378 66 0 264 3 thyA Thymidylate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q3JEI2 1.41e-132 378 64 0 264 3 thyA Thymidylate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
P54081 2.75e-132 377 66 0 264 3 thyA2 Thymidylate synthase 2 Bacillus amyloliquefaciens
Q0AHA4 5.73e-132 376 63 0 264 3 thyA Thymidylate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9PB13 8.68e-132 376 65 0 264 3 thyA Thymidylate synthase Xylella fastidiosa (strain 9a5c)
B8I0T8 9.48e-132 376 63 0 264 3 thyA Thymidylate synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A1SJ31 1.04e-131 376 63 1 273 3 thyA Thymidylate synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
E0U0H8 1.26e-131 375 65 0 264 3 thyA2 Thymidylate synthase 2 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
A4TCI9 1.29e-131 375 65 1 261 3 thyA Thymidylate synthase Mycolicibacterium gilvum (strain PYR-GCK)
Q87BT4 1.3e-131 375 65 0 264 3 thyA Thymidylate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A0JZC7 2.03e-131 375 66 0 261 3 thyA Thymidylate synthase Arthrobacter sp. (strain FB24)
Q1BA64 2.14e-131 375 63 1 261 3 thyA Thymidylate synthase Mycobacterium sp. (strain MCS)
A1UEU8 2.14e-131 375 63 1 261 3 thyA Thymidylate synthase Mycobacterium sp. (strain KMS)
A3PYA8 2.14e-131 375 63 1 261 3 thyA Thymidylate synthase Mycobacterium sp. (strain JLS)
Q211X8 2.99e-131 374 64 0 264 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain BisB18)
P59427 3.6e-131 374 60 0 264 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1VQZ6 5.55e-131 374 65 1 269 3 thyA Thymidylate synthase Polaromonas naphthalenivorans (strain CJ2)
Q8A639 1.11e-130 373 64 0 264 3 thyA Thymidylate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P9WFR9 1.55e-130 373 63 1 261 1 thyA Thymidylate synthase ThyA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR8 1.55e-130 373 63 1 261 3 thyA Thymidylate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6B7 1.55e-130 373 63 1 261 3 thyA Thymidylate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFM7 1.55e-130 373 63 1 261 3 thyA Thymidylate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KMA6 1.55e-130 373 63 1 261 3 thyA Thymidylate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P67045 1.55e-130 373 63 1 261 3 thyA Thymidylate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P11044 1.67e-130 373 64 0 264 1 thyA2 Thymidylate synthase 2 Bacillus subtilis (strain 168)
Q73VZ2 1.71e-130 373 63 1 261 3 thyA Thymidylate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QIU1 2.96e-130 372 63 1 261 3 thyA Thymidylate synthase Mycobacterium avium (strain 104)
A1T7P4 4.21e-130 372 64 1 261 3 thyA Thymidylate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q12CI6 4.24e-130 372 64 1 270 3 thyA Thymidylate synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q47II1 9.62e-130 371 65 0 264 3 thyA Thymidylate synthase Dechloromonas aromatica (strain RCB)
Q6N447 9.84e-130 370 63 0 264 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A8FEB9 1.21e-129 370 63 0 264 3 thyA Thymidylate synthase Bacillus pumilus (strain SAFR-032)
Q5L9L6 1.24e-129 370 64 0 264 3 thyA Thymidylate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6L1Q8 1.96e-129 370 63 0 264 3 thyA Thymidylate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A4YZC4 2.5e-129 370 62 0 264 3 thyA Thymidylate synthase Bradyrhizobium sp. (strain ORS 278)
Q64PV5 2.64e-129 370 64 0 264 3 thyA Thymidylate synthase Bacteroides fragilis (strain YCH46)
A0PQG7 2.65e-129 370 63 1 261 3 thyA Thymidylate synthase Mycobacterium ulcerans (strain Agy99)
A0LY29 3.74e-129 370 62 2 277 3 thyA Thymidylate synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q1QJT8 1.68e-128 367 62 0 264 3 thyA Thymidylate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SQ36 2.13e-128 367 64 0 264 3 thyA Thymidylate synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8FR47 2.56e-128 367 63 1 261 3 thyA Thymidylate synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B6JB67 2.71e-128 367 62 0 264 3 thyA Thymidylate synthase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2IYG7 3.53e-128 367 62 0 264 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain HaA2)
Q7MTB5 1.03e-127 365 62 0 264 3 thyA Thymidylate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q92NQ5 1.26e-127 365 63 0 264 3 thyA Thymidylate synthase Rhizobium meliloti (strain 1021)
Q8NS38 3.65e-127 364 63 1 261 1 thyA Thymidylate synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QCI7 3.65e-127 364 63 1 261 3 thyA Thymidylate synthase Corynebacterium glutamicum (strain R)
A6WZV4 3.72e-127 364 62 0 264 3 thyA Thymidylate synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P67043 4.1e-127 364 62 0 264 3 thyA Thymidylate synthase Brucella suis biovar 1 (strain 1330)
B0CHI7 4.1e-127 364 62 0 264 3 thyA Thymidylate synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
P67042 4.1e-127 364 62 0 264 1 thyA Thymidylate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE38 4.1e-127 364 62 0 264 3 thyA Thymidylate synthase Brucella melitensis biotype 2 (strain ATCC 23457)
Q57CA9 4.1e-127 364 62 0 264 3 thyA Thymidylate synthase Brucella abortus biovar 1 (strain 9-941)
Q2YS22 4.1e-127 364 62 0 264 3 thyA Thymidylate synthase Brucella abortus (strain 2308)
B9JXQ5 4.88e-127 364 62 0 264 3 thyA Thymidylate synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q6FZ91 5.82e-127 363 62 0 264 3 thyA Thymidylate synthase Bartonella quintana (strain Toulouse)
Q9CBW0 7.04e-127 363 63 1 261 3 thyA Thymidylate synthase Mycobacterium leprae (strain TN)
Q6G2S8 9.42e-127 363 62 0 264 3 thyA Thymidylate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A5EPD3 1.01e-126 363 62 0 264 3 thyA Thymidylate synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1R8Y7 1.07e-126 363 63 0 261 3 thyA Thymidylate synthase Paenarthrobacter aurescens (strain TC1)
Q8UDS3 1.35e-126 363 62 0 264 3 thyA Thymidylate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
A5VRE7 2.01e-126 362 62 0 264 3 thyA Thymidylate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M657 3.21e-126 362 61 0 264 3 thyA Thymidylate synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q4JX59 3.73e-126 362 62 1 261 3 thyA Thymidylate synthase Corynebacterium jeikeium (strain K411)
Q7UID0 1.3e-125 360 62 0 264 3 thyA Thymidylate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A6GWH3 1.38e-125 360 60 2 277 3 thyA Thymidylate synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q2W7P4 1.47e-125 360 63 0 264 3 thyA Thymidylate synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q1ME82 1.95e-125 360 61 0 264 3 thyA Thymidylate synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A6UB24 2.46e-125 360 62 0 264 3 thyA Thymidylate synthase Sinorhizobium medicae (strain WSM419)
C3PEY5 2.8e-125 360 62 1 261 3 thyA Thymidylate synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q21NW5 5.93e-125 359 60 1 277 3 thyA Thymidylate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1UTA5 1.37e-124 358 61 0 264 3 thyA Thymidylate synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q0C504 1.56e-124 357 61 0 264 3 thyA Thymidylate synthase Hyphomonas neptunium (strain ATCC 15444)
Q2K6G8 1.62e-124 357 61 0 264 3 thyA Thymidylate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A9IW82 2.22e-124 357 62 0 264 3 thyA Thymidylate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6NIF2 2.53e-124 357 61 1 261 3 thyA Thymidylate synthase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B0TYI1 2.91e-124 357 59 2 277 3 thyA Thymidylate synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q8D2N4 8.35e-124 356 60 0 264 3 thyA Thymidylate synthase Wigglesworthia glossinidia brevipalpis
A5FJV8 1.39e-123 356 58 3 286 3 thyA Thymidylate synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q98KH9 3.5e-123 354 61 0 264 3 thyA Thymidylate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A1WYP9 5.36e-123 353 60 0 264 3 thyA Thymidylate synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q0VM06 1.1e-122 353 60 1 277 3 thyA Thymidylate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B7I4U0 6.63e-122 352 61 3 280 1 thyA Thymidylate synthase Acinetobacter baumannii (strain AB0057)
B7H0P4 6.63e-122 352 61 3 280 3 thyA Thymidylate synthase Acinetobacter baumannii (strain AB307-0294)
Q11HI0 9.03e-122 350 60 0 264 3 thyA Thymidylate synthase Chelativorans sp. (strain BNC1)
A4IXE8 1.96e-121 350 58 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q7B4 1.96e-121 350 58 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. novicida (strain U112)
Q6FER7 3.5e-121 350 60 3 280 3 thyA Thymidylate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9A6H0 4.35e-121 349 61 1 263 3 thyA Thymidylate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C5BMA3 7.01e-121 349 58 1 277 3 thyA Thymidylate synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
B8ELI3 1.01e-120 348 62 1 269 3 thyA Thymidylate synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q5NFK5 1.93e-120 347 58 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H07 1.93e-120 347 58 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. tularensis (strain FSC 198)
A5WHY0 1.39e-119 346 58 2 277 3 thyA Thymidylate synthase Psychrobacter sp. (strain PRwf-1)
A5EVG5 3.55e-119 343 63 2 250 3 thyA Thymidylate synthase Dichelobacter nodosus (strain VCS1703A)
Q0BMM0 3.99e-119 344 57 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A486 3.99e-119 344 57 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NB78 3.99e-119 344 57 2 277 3 thyA Thymidylate synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q1Q8B2 1.49e-118 343 56 3 279 3 thyA Thymidylate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1GFV4 5.08e-118 342 58 2 277 3 thyA Thymidylate synthase Ruegeria sp. (strain TM1040)
Q603S2 1.07e-117 340 60 1 264 3 thyA Thymidylate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5WAK1 5.39e-117 339 56 1 277 3 thyA Thymidylate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q168V8 7.32e-117 338 56 1 277 3 thyA Thymidylate synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8G3T9 8.8e-116 335 60 2 265 3 thyA Thymidylate synthase Bifidobacterium longum (strain NCC 2705)
Q92AD4 1.6e-113 332 50 1 314 3 thyA Thymidylate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y626 1.88e-113 331 50 1 314 3 thyA Thymidylate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C1KWH4 2.19e-113 331 50 1 314 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q71YE1 3.01e-113 331 50 1 314 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4b (strain F2365)
Q81E05 3.52e-113 331 50 1 312 3 thyA Thymidylate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HJC7 4.01e-113 331 50 1 312 3 thyA Thymidylate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81R23 4.01e-113 331 50 1 312 3 thyA Thymidylate synthase Bacillus anthracis
A0RDL9 4.01e-113 331 50 1 312 3 thyA Thymidylate synthase Bacillus thuringiensis (strain Al Hakam)
Q63BV5 4.38e-113 330 50 1 312 3 thyA Thymidylate synthase Bacillus cereus (strain ZK / E33L)
Q738X7 4.53e-113 330 50 1 312 3 thyA Thymidylate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
B8DDM8 4.56e-113 330 50 1 314 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4a (strain HCC23)
C3K3Q8 8.24e-113 328 56 1 277 3 thyA Thymidylate synthase Pseudomonas fluorescens (strain SBW25)
A0AJY0 1.57e-112 329 50 1 314 3 thyA Thymidylate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A7GP90 2.07e-112 329 51 1 312 3 thyA Thymidylate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6A761 5.27e-110 321 55 2 270 3 thyA Thymidylate synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q6KIQ6 9.22e-110 321 52 3 293 3 thyA Thymidylate synthase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q834R3 8.03e-109 320 50 1 313 1 thyA Thymidylate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q98Q31 1.22e-107 315 52 3 293 3 thyA Thymidylate synthase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q88W05 4.93e-107 315 51 1 311 3 thyA Thymidylate synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8EQG0 5.44e-106 312 49 2 311 3 thyA Thymidylate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03S95 1.79e-105 311 50 1 313 3 thyA Thymidylate synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q4A611 4.6e-105 309 51 3 294 3 thyA Thymidylate synthase Mycoplasmopsis synoviae (strain 53)
P78029 5.65e-105 309 50 3 293 3 thyA Thymidylate synthase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A9NG27 5.84e-105 309 50 2 293 3 thyA Thymidylate synthase Acholeplasma laidlawii (strain PG-8A)
Q03F96 1.33e-103 306 50 2 313 3 thyA Thymidylate synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P67048 3.52e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain MW2)
Q6G9D4 3.52e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain MSSA476)
P67047 3.52e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain N315)
P67046 3.52e-103 305 49 2 311 1 thyA Thymidylate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISV8 3.52e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain JH9)
A6U1P7 3.52e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain JH1)
A7X2B3 3.52e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8Z406 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GGY0 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain MRSA252)
A6QGX8 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain Newman)
Q5HFZ6 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain COL)
Q2YY40 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FYK5 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH11 3.76e-103 305 49 2 311 3 thyA Thymidylate synthase Staphylococcus aureus (strain USA300)
Q4L6D7 9.19e-103 304 48 2 311 3 thyA Thymidylate synthase Staphylococcus haemolyticus (strain JCSC1435)
Q38WX8 1.26e-102 304 49 1 311 3 thyA Thymidylate synthase Latilactobacillus sakei subsp. sakei (strain 23K)
Q039F7 3.29e-102 303 49 1 311 3 thyA Thymidylate synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P0C0M5 4.42e-102 303 47 2 311 3 thyA Thymidylate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMP6 4.42e-102 303 47 2 311 3 thyA1 Thymidylate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A0M5 4.42e-102 303 47 2 311 3 thyA Thymidylate synthase Staphylococcus aureus
P47469 4.72e-101 299 49 3 293 3 thyA Thymidylate synthase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A5VJK9 5.26e-101 300 48 1 313 3 thyA Thymidylate synthase Limosilactobacillus reuteri (strain DSM 20016)
P00469 1.87e-100 298 49 1 311 1 thyA Thymidylate synthase Lacticaseibacillus casei
Q49XN8 1.87e-100 298 48 2 311 3 thyA Thymidylate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q27828 2.59e-100 303 51 4 282 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
Q1WU17 1.09e-99 296 47 1 311 3 thyA Thymidylate synthase Ligilactobacillus salivarius (strain UCC118)
C0QWM9 1.18e-99 295 51 4 267 3 thyA Thymidylate synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q9Z671 5.78e-99 294 49 3 292 3 thyA Thymidylate synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9XC19 4.07e-98 291 48 3 294 3 thyA Thymidylate synthase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
C3MEE8 1.43e-96 288 50 4 298 3 thyA Thymidylate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q6YQT0 1.56e-96 287 47 2 293 3 thyA Thymidylate synthase Onion yellows phytoplasma (strain OY-M)
P07607 1.68e-96 288 51 2 282 1 Tyms Thymidylate synthase Mus musculus
P04818 7.09e-96 286 51 2 282 1 TYMS Thymidylate synthase Homo sapiens
P45352 7.1e-96 286 50 2 282 1 Tyms Thymidylate synthase Rattus norvegicus
Q03YZ8 1.23e-95 286 48 4 318 3 thyA Thymidylate synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q6F145 1.49e-95 285 48 4 294 3 thyA Thymidylate synthase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q2NJ46 1.85e-95 285 47 2 293 3 thyA Thymidylate synthase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q04B29 4.74e-93 280 46 1 311 3 thyA Thymidylate synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAP2 4.74e-93 280 46 1 311 3 thyA Thymidylate synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q8EV81 5.1e-93 278 44 3 294 3 thyA Thymidylate synthase Malacoplasma penetrans (strain HF-2)
Q5FKL6 9.01e-93 279 46 2 311 3 thyA Thymidylate synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
O76511 8.48e-92 276 49 4 283 1 Ts Thymidylate synthase Drosophila melanogaster
B9JH03 1.15e-91 276 47 4 300 3 thyA Thymidylate synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
P06785 2.87e-91 275 48 6 294 1 CDC21 Thymidylate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A8YUW0 5.13e-91 275 45 1 311 3 thyA Thymidylate synthase Lactobacillus helveticus (strain DPC 4571)
A5VCW6 1.91e-90 273 47 4 302 3 thyA Thymidylate synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q044A1 2.33e-90 273 45 1 311 3 thyA Thymidylate synthase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
O81395 3.93e-90 279 48 3 282 2 DRTS Bifunctional dihydrofolate reductase-thymidylate synthase Zea mays
P12462 3.85e-89 269 46 2 282 3 TS Thymidylate synthase Herpesvirus ateles
Q3J0W9 5.94e-89 268 45 3 293 3 thyA Thymidylate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q27793 6.01e-89 276 49 4 284 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma cruzi
A3PLD1 6.69e-89 268 45 3 293 3 thyA Thymidylate synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WQT6 7.38e-89 268 46 4 293 3 thyA Thymidylate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q2G6V6 1.02e-88 268 45 5 301 3 thyA Thymidylate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P06854 2.13e-88 267 46 2 282 3 70 Thymidylate synthase Saimiriine herpesvirus 2 (strain 11)
Q05763 2.5e-88 275 49 3 281 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
Q2TA32 4.65e-88 268 45 4 320 2 TYMS Thymidylate synthase Bos taurus
P51820 5.83e-88 273 49 3 281 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
Q2QRX6 6.11e-88 272 48 3 282 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
Q07PP0 6.18e-88 266 46 3 292 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain BisA53)
Q89940 2.82e-87 264 46 2 282 3 70 Thymidylate synthase Equine herpesvirus 2 (strain 86/87)
P90463 3.91e-86 263 46 2 282 1 70 Thymidylate synthase Human herpesvirus 8 type P (isolate GK18)
Q05762 4.79e-86 268 47 4 281 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
P13100 1.94e-85 259 45 6 291 1 THYA Thymidylate synthase Pneumocystis carinii
Q74IU3 1.99e-85 260 44 1 311 3 thyA Thymidylate synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q27783 2.1e-85 267 46 4 284 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma brucei brucei
B3QZX0 9.49e-85 258 43 2 293 3 thyA Thymidylate synthase Phytoplasma mali (strain AT)
P07382 1.16e-84 265 47 5 286 1 LmjF06.0860 Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania major
P45350 1.91e-84 265 48 6 285 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
O62584 3.16e-84 256 47 4 279 1 TS-1 Thymidylate synthase 1/2 Encephalitozoon cuniculi (strain GB-M1)
Q4JQW2 3.55e-84 256 44 3 282 1 ORF13 Thymidylate synthase Varicella-zoster virus (strain Oka vaccine)
P09249 3.55e-84 256 44 3 282 3 ORF13 Thymidylate synthase Varicella-zoster virus (strain Dumas)
Q8SRG2 3.93e-84 256 47 4 279 3 TS-3 Thymidylate synthase 3 Encephalitozoon cuniculi (strain GB-M1)
Q1GTH6 3.95e-84 257 45 5 302 3 thyA Thymidylate synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P16126 1.02e-83 262 47 5 286 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania amazonensis
Q6QGJ5 1.12e-83 254 49 8 284 1 thy Probable thymidylate synthase Escherichia phage T5
P00471 3.46e-83 253 45 4 291 1 TD Thymidylate synthase Enterobacteria phage T4
P12461 3.58e-83 254 45 7 304 3 TMP1 Thymidylate synthase Candida albicans (strain SC5314 / ATCC MYA-2876)
O96650 3.6e-82 251 45 5 284 2 None Thymidylate synthase Ascaris suum
Q27713 4.61e-82 260 44 3 281 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium berghei (strain Anka)
P20712 8.16e-82 259 45 4 281 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium chabaudi
Q07422 1.78e-81 259 45 5 285 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii
Q04FR4 1.69e-80 248 41 2 314 3 thyA Thymidylate synthase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q67JQ1 1.7e-80 246 44 3 277 3 thyA Thymidylate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P13922 7.84e-80 254 44 3 281 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium falciparum (isolate K1 / Thailand)
O02604 2.67e-79 254 44 3 281 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium vivax
Q9UTI7 2.28e-77 249 45 9 295 3 SPAC15E1.04 Probable thymidylate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9P4T7 6.51e-77 238 44 7 291 3 tms1 Thymidylate synthase Agaricus bisporus
P0CS12 1.65e-75 235 45 8 286 1 TMP1 Thymidylate synthase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CS13 1.65e-75 235 45 8 286 3 TMP1 Thymidylate synthase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q23695 4.82e-74 237 45 8 285 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Crithidia fasciculata
Q9WBI3 1.03e-72 227 40 6 288 3 IIV6-225R Probable thymidylate synthase 225R Invertebrate iridescent virus 6
Q5UQG3 1.18e-60 203 37 6 291 3 MIMI_R497 Bifunctional dihydrofolate reductase-thymidylate synthase Acanthamoeba polyphaga mimivirus
Q87UL4 6.6e-60 195 34 5 323 3 thyA Thymidylate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88CN9 9.37e-59 192 34 5 323 3 thyA Thymidylate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q97EV3 1.96e-57 187 37 3 266 3 thyA Thymidylate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q7VUE3 7.85e-57 187 34 5 323 3 thyA Thymidylate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1A9 2.18e-56 186 34 5 323 3 thyA Thymidylate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WP13 2.18e-56 186 34 5 323 3 thyA Thymidylate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q59212 2.22e-54 179 36 4 275 3 thyA Thymidylate synthase Bacillus licheniformis
Q65J44 2.22e-54 179 36 4 275 3 thyA Thymidylate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A6M378 5.13e-54 178 36 4 265 3 thyA Thymidylate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9ANR7 3.69e-52 174 36 4 275 3 thyA Thymidylate synthase Bacillus mojavensis
E0TVT6 3.11e-51 171 35 4 275 3 thyA1 Thymidylate synthase 1 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
P0CI79 7.86e-51 171 35 4 275 1 thyA1 Thymidylate synthase 1 Bacillus subtilis (strain 168)
P07606 3.95e-50 169 34 4 275 3 thyP3 Thymidylate synthase Bacillus phage phi3T
Q5D189 1.24e-49 167 34 4 275 3 thyA Thymidylate synthase Bacillus subtilis subsp. natto
Q3IDN1 2.07e-48 164 35 5 283 3 thyA Thymidylate synthase Pseudoalteromonas translucida (strain TAC 125)
Q47Y31 8.55e-48 163 34 5 283 3 thyA Thymidylate synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5R064 9.32e-48 162 36 7 284 3 thyA Thymidylate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B0TIU4 1.07e-47 162 34 5 283 3 thyA Thymidylate synthase Shewanella halifaxensis (strain HAW-EB4)
Q9UWQ5 6.03e-47 162 32 7 331 3 thyA Thymidylate synthase Haloferax volcanii
A8H1B4 1.37e-45 157 33 5 283 3 thyA Thymidylate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
O30394 2.24e-45 155 38 2 212 3 thyA Thymidylate synthase (Fragment) Bacillus atrophaeus
O30397 2.58e-45 155 38 2 212 3 thyA1 Thymidylate synthase 1 (Fragment) Bacillus amyloliquefaciens
B8CQK7 8.75e-45 155 33 5 283 3 thyA Thymidylate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A8FSC3 1.98e-44 154 34 5 283 3 thyA Thymidylate synthase Shewanella sediminis (strain HAW-EB3)
A1SS96 2.3e-44 154 34 5 283 3 thyA Thymidylate synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q15P51 3.38e-44 154 33 5 283 3 thyA Thymidylate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A5UI47 4.32e-44 153 33 5 283 3 thyA Thymidylate synthase Haemophilus influenzae (strain PittGG)
Q5E7P1 4.32e-44 153 32 5 283 3 thyA Thymidylate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LUM1 6.42e-44 153 33 5 283 3 thyA Thymidylate synthase Photobacterium profundum (strain SS9)
P44420 1.23e-43 152 33 5 283 3 thyA Thymidylate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDH0 1.33e-43 152 33 5 283 3 thyA Thymidylate synthase Haemophilus influenzae (strain PittEE)
Q87SA0 1.37e-42 149 32 5 283 3 thyA Thymidylate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A3QBR4 1.48e-42 149 33 5 283 3 thyA Thymidylate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P57808 1.79e-42 149 31 5 283 3 thyA Thymidylate synthase Pasteurella multocida (strain Pm70)
B7VJ78 3.82e-42 148 32 5 283 3 thyA Thymidylate synthase Vibrio atlanticus (strain LGP32)
Q4QM04 5.32e-42 148 32 5 283 3 thyA Thymidylate synthase Haemophilus influenzae (strain 86-028NP)
B0UWT7 2.3e-41 146 31 5 283 3 thyA Thymidylate synthase Histophilus somni (strain 2336)
Q0I563 2.3e-41 146 31 5 283 3 thyA Thymidylate synthase Histophilus somni (strain 129Pt)
Q7MNN6 1e-40 144 32 5 283 3 thyA Thymidylate synthase Vibrio vulnificus (strain YJ016)
Q8DER9 1.09e-40 144 32 5 283 3 thyA Thymidylate synthase Vibrio vulnificus (strain CMCP6)
Q65VJ8 1.15e-40 144 32 5 283 3 thyA Thymidylate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q07YY3 1.2e-40 144 32 5 283 3 thyA Thymidylate synthase Shewanella frigidimarina (strain NCIMB 400)
A5F8Y6 1.41e-40 144 32 5 283 3 thyA Thymidylate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MXJ9 1.97e-40 144 31 5 283 3 thyA Thymidylate synthase Vibrio campbellii (strain ATCC BAA-1116)
C4LD19 2.98e-40 143 33 5 283 3 thyA Thymidylate synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C3LST0 3.21e-40 143 31 5 283 3 thyA Thymidylate synthase Vibrio cholerae serotype O1 (strain M66-2)
O66108 3.21e-40 143 31 5 283 3 thyA Thymidylate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6VMA0 7.22e-40 142 31 5 283 3 thyA Thymidylate synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A6W1R4 6.29e-39 140 32 5 283 3 thyA Thymidylate synthase Marinomonas sp. (strain MWYL1)
Q8RGP6 1.11e-38 139 35 6 254 3 thyA Thymidylate synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B8F6S2 2.07e-36 133 30 5 283 3 thyA Thymidylate synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q7VMH2 4.44e-36 132 31 5 283 3 thyA Thymidylate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P0C0M4 6.54e-33 119 54 1 98 3 thyA Thymidylate synthase (Fragment) Staphylococcus epidermidis
A4VUL1 1.56e-27 110 30 12 280 3 thyA Thymidylate synthase Streptococcus suis (strain 05ZYH33)
A4W0V3 1.56e-27 110 30 12 280 3 thyA Thymidylate synthase Streptococcus suis (strain 98HAH33)
C1CQE7 6.81e-27 108 30 13 280 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJD5 6.81e-27 108 30 13 280 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain P1031)
P67050 6.81e-27 108 30 13 280 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67049 6.81e-27 108 30 13 280 1 thyA Thymidylate synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1C631 6.81e-27 108 30 13 280 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain 70585)
Q04LL8 6.81e-27 108 30 13 280 3 thyA Thymidylate synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q48U25 2.43e-26 107 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF20 2.43e-26 107 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J744 2.43e-26 107 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHC5 2.43e-26 107 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8P1D1 2.43e-26 107 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCM3 2.43e-26 107 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
C1CD36 2.96e-26 106 30 12 263 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain JJA)
B8ZMQ1 2.96e-26 106 30 12 263 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
P0DG67 3.15e-26 106 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG66 3.15e-26 106 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67051 3.15e-26 106 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M1
Q1JM80 4.49e-26 106 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC96 4.49e-26 106 30 10 266 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
A8AXC2 1.49e-25 104 29 11 280 3 thyA Thymidylate synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q03LN3 1.68e-25 105 30 12 282 3 thyA Thymidylate synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M0S7 2.54e-25 104 30 12 282 3 thyA Thymidylate synthase Streptococcus thermophilus (strain CNRZ 1066)
Q5M5B3 3.58e-25 103 30 12 282 3 thyA Thymidylate synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
A3CMU9 4.51e-25 103 28 12 280 3 thyA Thymidylate synthase Streptococcus sanguinis (strain SK36)
Q8DUI4 4.84e-24 100 28 10 276 3 thyA Thymidylate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8E4L6 7.1e-24 100 28 12 276 3 thyA Thymidylate synthase Streptococcus agalactiae serotype III (strain NEM316)
Q3K0J7 7.1e-24 100 28 12 276 3 thyA Thymidylate synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8DZ07 1.06e-23 100 28 12 276 3 thyA Thymidylate synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q02Y43 2.45e-23 99 28 11 276 3 thyA Thymidylate synthase Lactococcus lactis subsp. cremoris (strain SK11)
P19368 6.54e-23 97 28 11 282 3 thyA Thymidylate synthase Lactococcus lactis subsp. lactis (strain IL1403)
P31654 3.16e-12 69 25 4 163 1 None Deoxyuridylate hydroxymethyltransferase Bacillus phage SP01
Q46E28 7.45e-08 55 28 1 117 3 thyA Putative thymidylate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8PXI1 9.03e-08 54 28 1 116 3 thyA Putative thymidylate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8THH4 1.49e-07 54 28 1 116 3 thyA Putative thymidylate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P80305 2.46e-06 50 25 1 133 1 thyA Putative thymidylate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O26868 1.43e-05 48 25 0 108 3 thyA Putative thymidylate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57931 1.53e-05 48 27 1 107 3 thyA Putative thymidylate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0DTK3 0.000118 46 25 7 166 1 None Deoxyuridylate hydroxymethyltransferase Pseudomonas phage M6

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15725
Feature type CDS
Gene thyA
Product thymidylate synthase
Location 147750 - 148544 (strand: 1)
Length 795 (nucleotides) / 264 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_281
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00303 Thymidylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0207 Nucleotide transport and metabolism (F) F Thymidylate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MKQYLELMQKVLDEGTPKDDRTGTGTLSIFGHQMRFNLQDGFPMVTTKRCHIRSIIHELLWFLQGDTNTQYLRDNGVTIWDEWADENGNLGPVYGKQWRAWGAADGTQIDQIKRVIEQLKSDPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHRQLSREPRALPKLIIKRKPASLFDYHFDDFEIEGYDPHPGIKAPVAI

Flanking regions ( +/- flanking 50bp)

ATATGGGCGTTTAAGCGTCCTGATAACCAAAAGAAAAGTGAAGAGGTAAAATGAAACAGTATCTGGAACTAATGCAGAAGGTGCTTGATGAAGGCACGCCAAAAGATGATCGTACCGGCACCGGTACTTTATCCATCTTCGGGCATCAGATGCGTTTCAATTTACAGGATGGTTTCCCGATGGTAACCACCAAGCGCTGTCATATCCGCTCTATCATTCATGAACTTCTGTGGTTTTTACAAGGTGATACCAACACGCAATATCTGCGCGATAACGGTGTGACTATCTGGGATGAATGGGCGGATGAAAACGGTAACCTGGGGCCGGTGTACGGCAAACAATGGCGCGCATGGGGTGCGGCAGACGGCACTCAGATTGACCAGATCAAACGCGTTATTGAACAGCTGAAAAGCGATCCTGACTCCCGCCGTATTATTGTTTCGGCCTGGAATGTCGGTGAACTTGATCAGATGGCTCTGGCGCCGTGCCATGCATTTTTCCAGTTCTATGTGGCAGACGGTAAGTTATCCTGCCAGTTGTATCAGCGCTCTTGTGATGTTTTCCTGGGTCTGCCGTTTAATATCGCCAGCTATGCCTTGTTAGTACATATGATGGCGCAGCAGTGTGACCTGGAAGTCGGCGACTTTGTCTGGACCGGTGGTGATACCCATCTGTACAGCAACCACATGGAACAGACTCACCGGCAGTTAAGCCGTGAGCCGCGTGCATTACCGAAACTGATTATCAAACGTAAACCGGCATCTCTGTTTGATTATCACTTCGATGATTTTGAAATTGAAGGCTATGATCCGCATCCGGGAATTAAAGCACCGGTTGCTATCTGATTTCAGCGCACACAGCGCACAGCAAAATCCAAATTGTTAAAGAGCGGCGG