Homologs in group_256

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06190 FBDBKF_06190 100.0 Morganella morganii S1 thyA thymidylate synthase
NLDBIP_09615 NLDBIP_09615 100.0 Morganella morganii S4 thyA thymidylate synthase
LHKJJB_08140 LHKJJB_08140 100.0 Morganella morganii S3 thyA thymidylate synthase
HKOGLL_07690 HKOGLL_07690 100.0 Morganella morganii S5 thyA thymidylate synthase
F4V73_RS15725 F4V73_RS15725 34.8 Morganella psychrotolerans thyA thymidylate synthase
F4V73_RS17895 F4V73_RS17895 27.9 Morganella psychrotolerans - thymidylate synthase
PMI_RS11465 PMI_RS11465 70.0 Proteus mirabilis HI4320 - thymidylate synthase

Distribution of the homologs in the orthogroup group_256

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_256

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B0TIU4 1.08e-147 419 64 2 311 3 thyA Thymidylate synthase Shewanella halifaxensis (strain HAW-EB4)
B8CQK7 1.02e-144 411 63 2 311 3 thyA Thymidylate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H1B4 3.4e-144 410 62 2 311 3 thyA Thymidylate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8FSC3 2.03e-143 408 63 2 311 3 thyA Thymidylate synthase Shewanella sediminis (strain HAW-EB3)
Q65VJ8 8.59e-143 406 63 1 311 3 thyA Thymidylate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q3IDN1 2.33e-142 405 62 1 311 3 thyA Thymidylate synthase Pseudoalteromonas translucida (strain TAC 125)
A5UDH0 3.64e-142 405 61 1 311 3 thyA Thymidylate synthase Haemophilus influenzae (strain PittEE)
A3QBR4 4.39e-142 405 62 2 311 3 thyA Thymidylate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5R064 2.34e-141 403 61 2 311 3 thyA Thymidylate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C4LD19 3.04e-141 402 63 2 311 3 thyA Thymidylate synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q87SA0 3.08e-141 402 61 2 311 3 thyA Thymidylate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UI47 3.29e-141 402 61 1 311 3 thyA Thymidylate synthase Haemophilus influenzae (strain PittGG)
P44420 3.67e-141 402 61 1 311 3 thyA Thymidylate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5F8Y6 6.41e-141 402 61 2 311 3 thyA Thymidylate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LST0 8.71e-141 401 61 2 311 3 thyA Thymidylate synthase Vibrio cholerae serotype O1 (strain M66-2)
O66108 8.71e-141 401 61 2 311 3 thyA Thymidylate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6VMA0 1.22e-140 401 61 1 311 3 thyA Thymidylate synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QM04 1.39e-140 401 61 1 311 3 thyA Thymidylate synthase Haemophilus influenzae (strain 86-028NP)
Q8DER9 1.64e-139 398 60 2 311 3 thyA Thymidylate synthase Vibrio vulnificus (strain CMCP6)
Q7MNN6 8.08e-139 396 60 2 311 3 thyA Thymidylate synthase Vibrio vulnificus (strain YJ016)
Q5E7P1 1.51e-138 396 60 1 311 3 thyA Thymidylate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P57808 2.44e-138 395 60 1 311 3 thyA Thymidylate synthase Pasteurella multocida (strain Pm70)
B0UWT7 6.32e-138 394 60 1 311 3 thyA Thymidylate synthase Histophilus somni (strain 2336)
Q0I563 6.32e-138 394 60 1 311 3 thyA Thymidylate synthase Histophilus somni (strain 129Pt)
Q6LUM1 2.68e-137 392 59 1 311 3 thyA Thymidylate synthase Photobacterium profundum (strain SS9)
Q07YY3 5.83e-137 392 60 2 311 3 thyA Thymidylate synthase Shewanella frigidimarina (strain NCIMB 400)
A7MXJ9 3.04e-136 390 59 2 311 3 thyA Thymidylate synthase Vibrio campbellii (strain ATCC BAA-1116)
B8F6S2 8.69e-136 389 58 1 311 3 thyA Thymidylate synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q15P51 5.49e-134 384 59 3 311 3 thyA Thymidylate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B7VJ78 6.06e-134 384 59 2 311 3 thyA Thymidylate synthase Vibrio atlanticus (strain LGP32)
A1SS96 4.95e-133 382 59 2 311 3 thyA Thymidylate synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7VMH2 5.52e-131 377 57 2 311 3 thyA Thymidylate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6W1R4 5.96e-131 377 57 2 311 3 thyA Thymidylate synthase Marinomonas sp. (strain MWYL1)
Q47Y31 6.51e-131 376 58 3 311 3 thyA Thymidylate synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7VUE3 4.79e-62 202 37 9 329 3 thyA Thymidylate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1A9 8.96e-61 199 37 9 327 3 thyA Thymidylate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WP13 8.96e-61 199 37 9 327 3 thyA Thymidylate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q88CN9 2.52e-51 175 32 10 330 3 thyA Thymidylate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q87UL4 3.94e-48 166 30 9 329 3 thyA Thymidylate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P07607 5.92e-43 152 32 8 310 1 Tyms Thymidylate synthase Mus musculus
P45352 2.79e-42 150 31 8 310 1 Tyms Thymidylate synthase Rattus norvegicus
C0ZI91 4.39e-41 146 31 7 311 3 thyA Thymidylate synthase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B7KQG2 6.18e-41 146 31 7 311 3 thyA Thymidylate synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
P04818 1.06e-40 147 32 9 310 1 TYMS Thymidylate synthase Homo sapiens
Q8A639 1.51e-40 145 31 7 305 3 thyA Thymidylate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
C1D070 1.58e-40 145 32 9 311 3 thyA Thymidylate synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
P06854 3.78e-40 145 29 8 311 3 70 Thymidylate synthase Saimiriine herpesvirus 2 (strain 11)
A7HVX4 7.28e-40 143 33 9 311 3 thyA Thymidylate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2W7P4 1.44e-39 142 30 7 311 3 thyA Thymidylate synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P06785 1.73e-39 143 32 10 321 1 CDC21 Thymidylate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q0AHA4 4.67e-39 141 32 8 311 3 thyA Thymidylate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q27793 6.48e-39 146 30 6 312 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma cruzi
B8I0T8 8.37e-39 140 31 7 311 3 thyA Thymidylate synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q5L9L6 1.24e-38 140 31 9 312 3 thyA Thymidylate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6LIC2 1.39e-38 140 29 6 311 3 thyA Thymidylate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
P90463 1.92e-38 141 29 5 309 1 70 Thymidylate synthase Human herpesvirus 8 type P (isolate GK18)
Q89940 2.38e-38 140 27 5 310 3 70 Thymidylate synthase Equine herpesvirus 2 (strain 86/87)
Q2QRX6 2.63e-38 144 29 5 309 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
O81395 2.81e-38 145 30 7 312 2 DRTS Bifunctional dihydrofolate reductase-thymidylate synthase Zea mays
Q64PV5 3.19e-38 139 31 9 312 3 thyA Thymidylate synthase Bacteroides fragilis (strain YCH46)
Q7MTB5 4.47e-38 139 30 6 305 3 thyA Thymidylate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A6UYE6 4.52e-38 139 30 6 311 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain PA7)
Q0C504 5.65e-38 138 30 7 311 3 thyA Thymidylate synthase Hyphomonas neptunium (strain ATCC 15444)
O62584 7.18e-38 139 31 8 305 1 TS-1 Thymidylate synthase 1/2 Encephalitozoon cuniculi (strain GB-M1)
Q8SRG2 1.13e-37 138 30 8 305 3 TS-3 Thymidylate synthase 3 Encephalitozoon cuniculi (strain GB-M1)
Q9I6F1 1.24e-37 137 29 6 311 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02U73 1.24e-37 137 29 6 311 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V2Q5 1.24e-37 137 29 6 311 3 thyA Thymidylate synthase Pseudomonas aeruginosa (strain LESB58)
B9JXQ5 1.26e-37 137 29 7 311 3 thyA Thymidylate synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q4JQW2 1.28e-37 138 30 7 309 1 ORF13 Thymidylate synthase Varicella-zoster virus (strain Oka vaccine)
P09249 1.28e-37 138 30 7 309 3 ORF13 Thymidylate synthase Varicella-zoster virus (strain Dumas)
B8GN06 1.77e-37 137 29 9 324 3 thyA Thymidylate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0ABR1 2.63e-37 136 30 9 311 3 thyA Thymidylate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q27828 2.81e-37 141 30 8 310 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
Q5WDS1 3.18e-37 136 31 8 311 3 thyA Thymidylate synthase Shouchella clausii (strain KSM-K16)
A6L1Q8 4.96e-37 136 31 8 299 3 thyA Thymidylate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q89G35 4.96e-37 136 30 7 311 3 thyA Thymidylate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8YUW0 5.68e-37 137 29 10 324 3 thyA Thymidylate synthase Lactobacillus helveticus (strain DPC 4571)
A8FEB9 6.6e-37 135 30 7 311 3 thyA Thymidylate synthase Bacillus pumilus (strain SAFR-032)
A5EPD3 7.33e-37 135 31 9 311 3 thyA Thymidylate synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8G3T9 7.87e-37 135 31 8 308 3 thyA Thymidylate synthase Bifidobacterium longum (strain NCC 2705)
Q1GFV4 9.09e-37 135 30 8 312 3 thyA Thymidylate synthase Ruegeria sp. (strain TM1040)
Q82WU3 1.02e-36 135 30 6 311 3 thyA Thymidylate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9K7B5 1.06e-36 135 29 7 311 3 thyA Thymidylate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q67JQ1 1.07e-36 135 29 8 316 3 thyA Thymidylate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q044A1 1.11e-36 136 30 8 323 3 thyA Thymidylate synthase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q7N8U4 1.12e-36 135 31 7 311 3 thyA Thymidylate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JPC9 1.21e-36 135 31 7 311 3 thyA Thymidylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q211X8 1.27e-36 135 30 6 311 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain BisB18)
Q667F9 1.44e-36 134 32 7 311 3 thyA Thymidylate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FFE0 1.44e-36 134 32 7 311 3 thyA Thymidylate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4YZC4 2.61e-36 134 29 8 311 3 thyA Thymidylate synthase Bradyrhizobium sp. (strain ORS 278)
Q05763 3.64e-36 139 29 7 309 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
C4L1C9 4.11e-36 133 28 7 311 3 thyA Thymidylate synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
O96650 4.53e-36 134 28 7 312 2 None Thymidylate synthase Ascaris suum
C1DK16 4.57e-36 133 29 8 311 3 thyA Thymidylate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P12462 6.35e-36 134 29 9 311 3 TS Thymidylate synthase Herpesvirus ateles
Q7NZ95 6.69e-36 133 30 7 311 3 thyA Thymidylate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4TLC5 7.28e-36 133 31 7 311 3 thyA Thymidylate synthase Yersinia pestis (strain Pestoides F)
Q1CFB5 7.28e-36 133 31 7 311 3 thyA Thymidylate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZHV1 7.28e-36 133 31 7 311 3 thyA Thymidylate synthase Yersinia pestis
Q1CAR9 7.28e-36 133 31 7 311 3 thyA Thymidylate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q3SH96 7.59e-36 133 30 7 311 3 thyA Thymidylate synthase Thiobacillus denitrificans (strain ATCC 25259)
P78029 7.7e-36 133 29 7 325 3 thyA Thymidylate synthase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q05762 7.77e-36 138 29 7 309 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
Q27713 8.18e-36 139 30 8 305 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium berghei (strain Anka)
Q9RAM7 1.1e-35 132 29 8 311 3 thyA1 Thymidylate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2K6G8 1.57e-35 132 28 7 311 3 thyA Thymidylate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q21NW5 1.74e-35 132 30 10 324 3 thyA Thymidylate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4Y044 2.18e-35 131 29 7 311 3 thyA Thymidylate synthase Pseudomonas mendocina (strain ymp)
Q6REU8 2.21e-35 131 31 7 311 3 thyA Thymidylate synthase Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q9XC19 2.52e-35 132 29 9 318 3 thyA Thymidylate synthase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
A1KAF7 3e-35 131 29 8 311 3 thyA Thymidylate synthase Azoarcus sp. (strain BH72)
Q6N447 3.12e-35 131 29 7 311 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1ME82 3.36e-35 131 28 7 311 3 thyA Thymidylate synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6KIQ6 3.52e-35 132 32 9 314 3 thyA Thymidylate synthase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
P51820 4.21e-35 136 30 8 309 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
Q8UDS3 4.97e-35 130 28 6 311 3 thyA Thymidylate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
A8GIH7 5.35e-35 130 31 7 311 3 thyA Thymidylate synthase Serratia proteamaculans (strain 568)
Q1QJT8 5.35e-35 130 29 6 311 3 thyA Thymidylate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A6UB24 6.2e-35 130 29 9 311 3 thyA Thymidylate synthase Sinorhizobium medicae (strain WSM419)
Q5FKL6 6.38e-35 132 28 10 324 3 thyA Thymidylate synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A0KG32 8.98e-35 130 29 6 311 3 thyA Thymidylate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3D1U3 9.07e-35 130 31 8 311 3 thyA Thymidylate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
C5BMA3 9.42e-35 130 29 7 324 3 thyA Thymidylate synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
C6DAE9 9.66e-35 130 31 7 311 3 thyA Thymidylate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q27783 9.99e-35 135 30 6 310 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma brucei brucei
Q1QUD9 1.18e-34 129 30 8 311 3 thyA Thymidylate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2TA32 1.19e-34 132 28 8 347 2 TYMS Thymidylate synthase Bos taurus
A4SIW7 1.35e-34 129 29 7 311 3 thyA Thymidylate synthase Aeromonas salmonicida (strain A449)
A4VGL9 1.49e-34 129 29 7 311 3 thyA Thymidylate synthase Stutzerimonas stutzeri (strain A1501)
A4WE03 1.67e-34 129 30 7 311 3 thyA Thymidylate synthase Enterobacter sp. (strain 638)
P20712 1.68e-34 135 30 8 305 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium chabaudi
Q04B29 2.22e-34 130 31 12 329 3 thyA Thymidylate synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAP2 2.22e-34 130 31 12 329 3 thyA Thymidylate synthase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q134B1 2.27e-34 129 28 6 311 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain BisB5)
Q63BV5 2.46e-34 130 29 11 331 3 thyA Thymidylate synthase Bacillus cereus (strain ZK / E33L)
P16126 2.46e-34 134 30 8 313 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania amazonensis
Q738X7 2.49e-34 130 30 11 327 3 thyA Thymidylate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6D8I6 2.52e-34 129 31 7 311 3 thyA Thymidylate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B8EBR5 2.72e-34 129 31 8 311 3 thyA Thymidylate synthase Shewanella baltica (strain OS223)
Q8ZMA9 2.86e-34 129 30 7 311 3 thyA Thymidylate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N2L7 2.86e-34 129 30 7 311 3 thyA Thymidylate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEN6 2.86e-34 129 30 7 311 3 thyA Thymidylate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57KB6 2.86e-34 129 30 7 311 3 thyA Thymidylate synthase Salmonella choleraesuis (strain SC-B67)
A9MS82 3.21e-34 128 30 7 311 3 thyA Thymidylate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P07382 3.4e-34 134 29 7 313 1 LmjF06.0860 Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania major
O76511 3.55e-34 130 29 10 312 1 Ts Thymidylate synthase Drosophila melanogaster
A9L5M3 3.76e-34 128 31 8 311 3 thyA Thymidylate synthase Shewanella baltica (strain OS195)
A6WKP4 3.76e-34 128 31 8 311 3 thyA Thymidylate synthase Shewanella baltica (strain OS185)
Q3SQ36 4.01e-34 128 29 8 311 3 thyA Thymidylate synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8PCE7 6.18e-34 128 30 8 311 3 thyA Thymidylate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UR35 6.18e-34 128 30 8 311 3 thyA Thymidylate synthase Xanthomonas campestris pv. campestris (strain 8004)
E0U0H8 6.51e-34 127 27 6 311 3 thyA2 Thymidylate synthase 2 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
A1KVB3 7.01e-34 127 29 7 311 3 thyA Thymidylate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P13922 7.18e-34 133 29 8 305 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium falciparum (isolate K1 / Thailand)
Q9JY72 7.23e-34 127 29 7 311 3 thyA Thymidylate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
C0PXI9 8.12e-34 127 30 7 311 3 thyA Thymidylate synthase Salmonella paratyphi C (strain RKS4594)
Q81E05 9.67e-34 129 29 11 327 3 thyA Thymidylate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HJC7 1.03e-33 129 29 11 327 3 thyA Thymidylate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81R23 1.03e-33 129 29 11 327 3 thyA Thymidylate synthase Bacillus anthracis
A0RDL9 1.03e-33 129 29 11 327 3 thyA Thymidylate synthase Bacillus thuringiensis (strain Al Hakam)
Q5P233 1.07e-33 127 29 6 311 3 thyA Thymidylate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8Z412 1.08e-33 127 30 7 311 3 thyA Thymidylate synthase Salmonella typhi
Q9JT57 1.19e-33 127 29 7 311 3 thyA Thymidylate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B8IF20 1.19e-33 127 27 7 311 3 thyA Thymidylate synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q8EH94 1.3e-33 127 30 6 311 3 thyA Thymidylate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5YPL7 1.31e-33 127 30 10 309 3 thyA Thymidylate synthase Nocardia farcinica (strain IFM 10152)
Q168V8 1.32e-33 127 29 8 312 3 thyA Thymidylate synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1WYP9 1.45e-33 127 27 7 311 3 thyA Thymidylate synthase Halorhodospira halophila (strain DSM 244 / SL1)
A0JZC7 1.49e-33 127 29 9 308 3 thyA Thymidylate synthase Arthrobacter sp. (strain FB24)
Q0HSH8 1.66e-33 127 31 8 311 3 thyA Thymidylate synthase Shewanella sp. (strain MR-7)
Q0HG85 1.66e-33 127 31 8 311 3 thyA Thymidylate synthase Shewanella sp. (strain MR-4)
Q5F732 1.68e-33 127 29 7 311 3 thyA Thymidylate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
C3PEY5 1.81e-33 127 29 8 309 3 thyA Thymidylate synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q6FER7 1.92e-33 127 30 10 313 3 thyA Thymidylate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O02604 2.13e-33 132 30 9 308 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium vivax
A6M378 2.13e-33 126 29 9 313 3 thyA Thymidylate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A9NG27 2.21e-33 127 28 7 323 3 thyA Thymidylate synthase Acholeplasma laidlawii (strain PG-8A)
A0KZP5 2.5e-33 126 31 8 311 3 thyA Thymidylate synthase Shewanella sp. (strain ANA-3)
Q0VM06 2.61e-33 126 29 9 324 3 thyA Thymidylate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3BX87 2.61e-33 126 29 7 311 3 thyA Thymidylate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A7Z5T3 2.67e-33 126 27 6 311 3 thyA Thymidylate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5WHY0 2.71e-33 127 29 8 309 3 thyA Thymidylate synthase Psychrobacter sp. (strain PRwf-1)
O33380 3.41e-33 126 29 8 312 3 thyA Thymidylate synthase Neisseria gonorrhoeae
P12461 3.42e-33 127 30 10 333 3 TMP1 Thymidylate synthase Candida albicans (strain SC5314 / ATCC MYA-2876)
A7MR31 3.47e-33 125 30 6 311 3 thyA Thymidylate synthase Cronobacter sakazakii (strain ATCC BAA-894)
A1RME0 3.9e-33 125 31 8 311 3 thyA Thymidylate synthase Shewanella sp. (strain W3-18-1)
A4Y4J1 3.9e-33 125 31 8 311 3 thyA Thymidylate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q92NQ5 4.02e-33 125 28 8 311 3 thyA Thymidylate synthase Rhizobium meliloti (strain 1021)
C5BH86 4.96e-33 125 29 7 311 3 thyA Thymidylate synthase Edwardsiella ictaluri (strain 93-146)
A9M657 5.75e-33 125 28 8 311 3 thyA Thymidylate synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B7LNI2 5.81e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q32C94 6.25e-33 125 29 7 311 3 thyA Thymidylate synthase Shigella dysenteriae serotype 1 (strain Sd197)
B1IU17 6.32e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3W0 6.32e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O9:H4 (strain HS)
Q2IYG7 6.8e-33 125 28 6 311 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain HaA2)
A8Z406 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GGY0 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain MRSA252)
A6QGX8 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain Newman)
Q5HFZ6 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain COL)
Q2YY40 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FYK5 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH11 7.1e-33 126 29 9 322 3 thyA Thymidylate synthase Staphylococcus aureus (strain USA300)
Q8PP46 7.64e-33 125 29 8 311 3 thyA Thymidylate synthase Xanthomonas axonopodis pv. citri (strain 306)
Q3YY33 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Shigella sonnei (strain Ss046)
Q1R7I6 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli (strain UTI89 / UPEC)
B7N759 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A884 8.57e-33 125 29 7 311 1 thyA Thymidylate synthase Escherichia coli (strain K12)
P0A885 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TE05 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AF39 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O1:K1 / APEC
C4ZZX9 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LY83 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O8 (strain IAI1)
B7MZC6 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O81 (strain ED1a)
B7NVX2 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0A886 8.57e-33 125 29 7 311 1 thyA Thymidylate synthase Escherichia coli O157:H7
B7LF04 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli (strain 55989 / EAEC)
B7MLH3 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHP4 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQT3 8.57e-33 125 29 7 311 3 thyA Thymidylate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TDG3 8.75e-33 125 29 6 311 3 thyA Thymidylate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5GWB5 9.23e-33 124 29 8 311 3 thyA Thymidylate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZH9 9.23e-33 124 29 8 311 3 thyA Thymidylate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A8AP42 9.52e-33 124 29 6 311 3 thyA Thymidylate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q31XG0 9.93e-33 124 29 7 311 3 thyA Thymidylate synthase Shigella boydii serotype 4 (strain Sb227)
P67043 1.11e-32 124 29 9 311 3 thyA Thymidylate synthase Brucella suis biovar 1 (strain 1330)
B0CHI7 1.11e-32 124 29 9 311 3 thyA Thymidylate synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
P67042 1.11e-32 124 29 9 311 1 thyA Thymidylate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE38 1.11e-32 124 29 9 311 3 thyA Thymidylate synthase Brucella melitensis biotype 2 (strain ATCC 23457)
Q57CA9 1.11e-32 124 29 9 311 3 thyA Thymidylate synthase Brucella abortus biovar 1 (strain 9-941)
Q2YS22 1.11e-32 124 29 9 311 3 thyA Thymidylate synthase Brucella abortus (strain 2308)
Q11HI0 1.35e-32 124 29 8 311 3 thyA Thymidylate synthase Chelativorans sp. (strain BNC1)
P48464 1.45e-32 124 29 7 311 2 thyA Thymidylate synthase Shigella flexneri
Q0T137 1.45e-32 124 29 7 311 3 thyA Thymidylate synthase Shigella flexneri serotype 5b (strain 8401)
P54081 1.61e-32 124 27 6 311 3 thyA2 Thymidylate synthase 2 Bacillus amyloliquefaciens
P13100 1.81e-32 125 26 7 317 1 THYA Thymidylate synthase Pneumocystis carinii
Q98KH9 1.92e-32 124 30 10 311 3 thyA Thymidylate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P67048 2.19e-32 125 29 9 320 3 thyA Thymidylate synthase Staphylococcus aureus (strain MW2)
Q6G9D4 2.19e-32 125 29 9 320 3 thyA Thymidylate synthase Staphylococcus aureus (strain MSSA476)
P67047 2.19e-32 125 29 9 320 3 thyA Thymidylate synthase Staphylococcus aureus (strain N315)
P67046 2.19e-32 125 29 9 320 1 thyA Thymidylate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISV8 2.19e-32 125 29 9 320 3 thyA Thymidylate synthase Staphylococcus aureus (strain JH9)
A6U1P7 2.19e-32 125 29 9 320 3 thyA Thymidylate synthase Staphylococcus aureus (strain JH1)
A7X2B3 2.19e-32 125 29 9 320 3 thyA Thymidylate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q97EV3 2.2e-32 124 30 9 312 3 thyA Thymidylate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2NRH3 2.35e-32 124 30 7 311 3 thyA Thymidylate synthase Sodalis glossinidius (strain morsitans)
Q23695 3.66e-32 128 28 9 311 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Crithidia fasciculata
Q03S95 3.96e-32 124 30 11 323 3 thyA Thymidylate synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A5VRE7 3.97e-32 123 29 9 311 3 thyA Thymidylate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P45350 4.46e-32 128 29 7 309 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
A0LY29 5.22e-32 123 27 8 324 3 thyA Thymidylate synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q03YZ8 5.23e-32 124 28 7 326 3 thyA Thymidylate synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A7GP90 6.39e-32 124 29 11 329 3 thyA Thymidylate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6FZ91 7.53e-32 122 29 9 311 3 thyA Thymidylate synthase Bartonella quintana (strain Toulouse)
B8ELI3 8.37e-32 122 28 7 316 3 thyA Thymidylate synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q11VK5 8.63e-32 122 29 8 311 3 thyA Thymidylate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q12KG8 9.69e-32 122 28 8 311 3 thyA Thymidylate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P11044 1.05e-31 122 27 6 311 1 thyA2 Thymidylate synthase 2 Bacillus subtilis (strain 168)
Q74IU3 2.03e-31 122 29 10 324 3 thyA Thymidylate synthase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B7I4U0 2.45e-31 121 27 7 312 1 thyA Thymidylate synthase Acinetobacter baumannii (strain AB0057)
B7H0P4 2.45e-31 121 27 7 312 3 thyA Thymidylate synthase Acinetobacter baumannii (strain AB307-0294)
Q1Q8B2 2.75e-31 121 29 10 311 3 thyA Thymidylate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q9PB13 2.79e-31 120 28 7 311 3 thyA Thymidylate synthase Xylella fastidiosa (strain 9a5c)
A6WGF9 3.77e-31 120 29 8 309 3 thyA Thymidylate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B6JB67 5.64e-31 120 28 7 311 3 thyA Thymidylate synthase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q49XN8 5.97e-31 121 29 7 321 3 thyA Thymidylate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1R8Y7 9.17e-31 119 28 9 308 3 thyA Thymidylate synthase Paenarthrobacter aurescens (strain TC1)
Q07422 1e-30 124 29 10 313 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Toxoplasma gondii
Q47II1 1.1e-30 119 27 7 311 3 thyA Thymidylate synthase Dechloromonas aromatica (strain RCB)
Q9A6H0 1.21e-30 119 29 7 309 3 thyA Thymidylate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C1D4I5 1.4e-30 119 28 7 311 3 thyA Thymidylate synthase Laribacter hongkongensis (strain HLHK9)
A6WZV4 1.84e-30 119 27 7 311 3 thyA Thymidylate synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1W5A4 1.91e-30 119 29 9 317 3 thyA Thymidylate synthase Acidovorax sp. (strain JS42)
Q7UID0 2.62e-30 118 27 7 311 3 thyA Thymidylate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A0PQG7 2.69e-30 118 29 8 308 3 thyA Thymidylate synthase Mycobacterium ulcerans (strain Agy99)
Q6G2S8 2.97e-30 118 28 8 311 3 thyA Thymidylate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1WU17 3.44e-30 119 29 9 321 3 thyA Thymidylate synthase Ligilactobacillus salivarius (strain UCC118)
Q83BG2 4.91e-30 117 29 9 315 3 thyA Thymidylate synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N980 4.91e-30 117 29 9 315 3 thyA Thymidylate synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KF61 4.91e-30 117 29 9 315 3 thyA Thymidylate synthase Coxiella burnetii (strain Dugway 5J108-111)
Q6NIF2 5.11e-30 117 28 8 308 3 thyA Thymidylate synthase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
P47469 5.13e-30 118 28 7 321 3 thyA Thymidylate synthase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8Y0U6 5.4e-30 117 28 8 311 3 thyA Thymidylate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P0CS12 5.72e-30 119 28 8 308 1 TMP1 Thymidylate synthase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CS13 5.72e-30 119 28 8 308 3 TMP1 Thymidylate synthase Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q87BT4 6.18e-30 117 28 7 311 3 thyA Thymidylate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
C3MEE8 6.77e-30 118 28 8 316 3 thyA Thymidylate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q38WX8 8.06e-30 118 30 9 319 3 thyA Thymidylate synthase Latilactobacillus sakei subsp. sakei (strain 23K)
A5II41 9.19e-30 117 29 7 311 3 thyA Thymidylate synthase Legionella pneumophila (strain Corby)
Q6A761 9.55e-30 117 28 9 317 3 thyA Thymidylate synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
B8D9L8 1.14e-29 116 29 8 311 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7X0 1.18e-29 116 29 8 311 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q5X119 1.27e-29 116 28 6 311 3 thyA Thymidylate synthase Legionella pneumophila (strain Paris)
A1SJ31 1.33e-29 116 28 9 320 3 thyA Thymidylate synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q5WSU5 1.6e-29 116 29 8 311 3 thyA Thymidylate synthase Legionella pneumophila (strain Lens)
A4TCI9 1.62e-29 116 29 10 308 3 thyA Thymidylate synthase Mycolicibacterium gilvum (strain PYR-GCK)
Q9CBW0 2.04e-29 116 29 7 308 3 thyA Thymidylate synthase Mycobacterium leprae (strain TN)
Q834R3 2.16e-29 117 30 8 322 1 thyA Thymidylate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q0K889 2.35e-29 115 29 9 311 3 thyA Thymidylate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9ANR7 2.44e-29 116 27 10 321 3 thyA Thymidylate synthase Bacillus mojavensis
A1UTA5 2.58e-29 115 27 8 311 3 thyA Thymidylate synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
P57515 2.75e-29 115 29 8 311 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0AJY0 2.8e-29 117 29 11 329 3 thyA Thymidylate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5KZ25 2.84e-29 115 28 6 311 3 thyA Thymidylate synthase Geobacillus kaustophilus (strain HTA426)
A0QVR9 3.09e-29 115 29 8 308 3 thyA Thymidylate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0SEI1 3.43e-29 115 27 8 308 3 thyA Thymidylate synthase Rhodococcus jostii (strain RHA1)
Q4A611 3.62e-29 115 28 9 314 3 thyA Thymidylate synthase Mycoplasmopsis synoviae (strain 53)
Q9UTI7 3.64e-29 120 30 11 319 3 SPAC15E1.04 Probable thymidylate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8K9C3 4.17e-29 115 30 9 311 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C4K7G3 4.4e-29 115 28 7 311 3 thyA Thymidylate synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A4INY1 5.09e-29 115 27 6 311 3 thyA Thymidylate synthase Geobacillus thermodenitrificans (strain NG80-2)
Q5ZRL3 5.36e-29 115 28 7 311 3 thyA Thymidylate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
C5DAR2 6.47e-29 114 27 6 311 3 thyA Thymidylate synthase Geobacillus sp. (strain WCH70)
Q6YQT0 6.55e-29 115 29 10 303 3 thyA Thymidylate synthase Onion yellows phytoplasma (strain OY-M)
Q039F7 7.14e-29 115 30 12 324 3 thyA Thymidylate synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q04FR4 7.4e-29 115 26 7 323 3 thyA Thymidylate synthase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6AFI0 8.17e-29 114 27 8 308 3 thyA Thymidylate synthase Leifsonia xyli subsp. xyli (strain CTCB07)
A5FJV8 1.05e-28 114 27 9 333 3 thyA Thymidylate synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
P59427 2.1e-28 113 28 8 314 3 thyA Thymidylate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1S3W8 2.84e-28 113 28 8 311 3 thyA Thymidylate synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8Y626 3.4e-28 114 28 9 328 3 thyA Thymidylate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92AD4 3.51e-28 114 28 9 328 3 thyA Thymidylate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q73VZ2 3.61e-28 112 28 8 308 3 thyA Thymidylate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QIU1 3.65e-28 112 28 8 308 3 thyA Thymidylate synthase Mycobacterium avium (strain 104)
Q6MID2 4.48e-28 112 27 6 311 3 thyA Thymidylate synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A9IW82 4.67e-28 112 27 8 311 3 thyA Thymidylate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
B9JH03 1.14e-27 112 28 9 341 3 thyA Thymidylate synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A5VJK9 1.25e-27 112 29 12 324 3 thyA Thymidylate synthase Limosilactobacillus reuteri (strain DSM 20016)
A4SVT7 1.41e-27 111 27 8 311 3 thyA Thymidylate synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q98Q31 1.47e-27 111 30 10 309 3 thyA Thymidylate synthase Mycoplasmopsis pulmonis (strain UAB CTIP)
A1VQZ6 1.81e-27 111 30 10 318 3 thyA Thymidylate synthase Polaromonas naphthalenivorans (strain CJ2)
C1KWH4 1.84e-27 112 28 9 328 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DDM8 1.9e-27 112 28 9 328 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q71YE1 1.96e-27 112 28 9 328 3 thyA Thymidylate synthase Listeria monocytogenes serotype 4b (strain F2365)
P9WFR9 2.07e-27 110 27 7 308 1 thyA Thymidylate synthase ThyA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR8 2.07e-27 110 27 7 308 3 thyA Thymidylate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6B7 2.07e-27 110 27 7 308 3 thyA Thymidylate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFM7 2.07e-27 110 27 7 308 3 thyA Thymidylate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KMA6 2.07e-27 110 27 7 308 3 thyA Thymidylate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P67045 2.07e-27 110 27 7 308 3 thyA Thymidylate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2SA17 2.11e-27 110 27 6 311 3 thyA Thymidylate synthase Hahella chejuensis (strain KCTC 2396)
A1TM53 2.25e-27 110 29 11 318 3 thyA Thymidylate synthase Paracidovorax citrulli (strain AAC00-1)
Q1BA64 2.32e-27 110 28 7 308 3 thyA Thymidylate synthase Mycobacterium sp. (strain MCS)
A1UEU8 2.32e-27 110 28 7 308 3 thyA Thymidylate synthase Mycobacterium sp. (strain KMS)
A3PYA8 2.32e-27 110 28 7 308 3 thyA Thymidylate synthase Mycobacterium sp. (strain JLS)
E0TVT6 3.93e-27 110 26 11 322 3 thyA1 Thymidylate synthase 1 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
Q2NJ46 4.03e-27 110 27 8 317 3 thyA Thymidylate synthase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q2G6V6 4.1e-27 111 28 9 321 3 thyA Thymidylate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P0C0M5 4.55e-27 110 27 9 328 3 thyA Thymidylate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMP6 4.55e-27 110 27 9 328 3 thyA1 Thymidylate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A0M5 4.55e-27 110 27 9 328 3 thyA Thymidylate synthase Staphylococcus aureus
P00471 4.97e-27 110 28 9 329 1 TD Thymidylate synthase Enterobacteria phage T4
A1T7P4 9.89e-27 108 28 10 308 3 thyA Thymidylate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q31I55 1.02e-26 109 27 8 324 3 thyA Thymidylate synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P00469 1.03e-26 110 29 11 323 1 thyA Thymidylate synthase Lacticaseibacillus casei
Q1LK81 1.2e-26 108 28 8 312 3 thyA Thymidylate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0CI79 1.4e-26 108 27 10 321 1 thyA1 Thymidylate synthase 1 Bacillus subtilis (strain 168)
A5CWK3 1.59e-26 108 27 6 311 3 thyA Thymidylate synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A6GWH3 2.24e-26 108 26 9 324 3 thyA Thymidylate synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q1LSU0 2.43e-26 107 28 9 311 3 thyA Thymidylate synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q21U56 3.82e-26 107 30 12 318 3 thyA Thymidylate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C0QWM9 4.04e-26 107 26 10 315 3 thyA Thymidylate synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q9Z671 4.4e-26 107 26 7 326 3 thyA Thymidylate synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q59212 5.59e-26 107 27 10 321 3 thyA Thymidylate synthase Bacillus licheniformis
Q65J44 5.59e-26 107 27 10 321 3 thyA Thymidylate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5EVG5 5.79e-26 106 29 6 268 3 thyA Thymidylate synthase Dichelobacter nodosus (strain VCS1703A)
Q4L6D7 8.33e-26 107 27 8 324 3 thyA Thymidylate synthase Staphylococcus haemolyticus (strain JCSC1435)
Q12CI6 8.74e-26 107 29 10 318 3 thyA Thymidylate synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
P07606 8.88e-26 106 26 10 321 3 thyP3 Thymidylate synthase Bacillus phage phi3T
Q1GTH6 9.15e-26 107 27 10 326 3 thyA Thymidylate synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q8EQG0 1.39e-25 107 26 9 328 3 thyA Thymidylate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q03F96 1.71e-25 106 26 9 327 3 thyA Thymidylate synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q603S2 1.98e-25 105 27 6 311 3 thyA Thymidylate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9WBI3 2.05e-25 106 25 9 308 3 IIV6-225R Probable thymidylate synthase 225R Invertebrate iridescent virus 6
Q6F145 3.66e-25 105 28 9 323 3 thyA Thymidylate synthase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q4JX59 3.85e-25 104 27 8 308 3 thyA Thymidylate synthase Corynebacterium jeikeium (strain K411)
Q9P4T7 3.99e-25 105 26 9 318 3 tms1 Thymidylate synthase Agaricus bisporus
Q5D189 6.14e-25 104 26 10 321 3 thyA Thymidylate synthase Bacillus subtilis subsp. natto
Q3JEI2 1.45e-24 103 26 8 312 3 thyA Thymidylate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B7GI39 1.48e-24 103 27 7 311 3 thyA Thymidylate synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q88W05 1.63e-24 103 27 11 329 3 thyA Thymidylate synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
O30397 3.69e-24 101 27 7 273 3 thyA1 Thymidylate synthase 1 (Fragment) Bacillus amyloliquefaciens
Q8NS38 4.17e-24 102 25 7 308 1 thyA Thymidylate synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QCI7 4.17e-24 102 25 7 308 3 thyA Thymidylate synthase Corynebacterium glutamicum (strain R)
Q8EV81 6.42e-24 102 26 9 329 3 thyA Thymidylate synthase Malacoplasma penetrans (strain HF-2)
Q8FR47 7.71e-24 101 26 7 308 3 thyA Thymidylate synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8D2N4 8.31e-24 101 27 9 313 3 thyA Thymidylate synthase Wigglesworthia glossinidia brevipalpis
O30394 1.71e-23 99 27 6 271 3 thyA Thymidylate synthase (Fragment) Bacillus atrophaeus
A4WQT6 2.28e-23 100 27 9 312 3 thyA Thymidylate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B3QZX0 4.47e-23 99 26 9 324 3 thyA Thymidylate synthase Phytoplasma mali (strain AT)
A2SHH0 9.62e-23 98 27 10 317 3 thyA Thymidylate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1AWQ8 1.51e-22 97 26 6 280 3 thyA Thymidylate synthase Ruthia magnifica subsp. Calyptogena magnifica
A5WAK1 1.75e-22 97 25 10 313 3 thyA Thymidylate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A3PLD1 7.3e-22 96 26 9 312 3 thyA Thymidylate synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q3J0W9 1.07e-21 95 26 9 312 3 thyA Thymidylate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A1U3D8 4.37e-21 94 25 8 327 3 thyA Thymidylate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A5VCW6 1.44e-20 93 26 11 334 3 thyA Thymidylate synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q6QGJ5 1.46e-20 92 27 10 318 1 thy Probable thymidylate synthase Escherichia phage T5
Q8RGP6 1.81e-20 92 25 10 316 3 thyA Thymidylate synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q07PP0 2.58e-20 92 26 7 310 3 thyA Thymidylate synthase Rhodopseudomonas palustris (strain BisA53)
B0TYI1 1.98e-18 86 25 8 324 3 thyA Thymidylate synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0BMM0 5.87e-18 85 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A486 5.87e-18 85 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NB78 5.87e-18 85 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NFK5 6.11e-18 85 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14H07 6.11e-18 85 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. tularensis (strain FSC 198)
A4IXE8 1.28e-17 84 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q7B4 1.28e-17 84 25 9 324 3 thyA Thymidylate synthase Francisella tularensis subsp. novicida (strain U112)
A4VUL1 4.12e-16 80 25 11 312 3 thyA Thymidylate synthase Streptococcus suis (strain 05ZYH33)
A4W0V3 4.12e-16 80 25 11 312 3 thyA Thymidylate synthase Streptococcus suis (strain 98HAH33)
Q9UWQ5 1.41e-15 79 29 10 251 3 thyA Thymidylate synthase Haloferax volcanii
C1CQE7 1e-14 76 26 15 313 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJD5 1e-14 76 26 15 313 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain P1031)
P67050 1e-14 76 26 15 313 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67049 1e-14 76 26 15 313 1 thyA Thymidylate synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1C631 1e-14 76 26 15 313 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain 70585)
Q04LL8 1e-14 76 26 15 313 3 thyA Thymidylate synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5UQG3 1.22e-14 77 24 10 309 3 MIMI_R497 Bifunctional dihydrofolate reductase-thymidylate synthase Acanthamoeba polyphaga mimivirus
Q5M5B3 1.49e-14 75 26 14 316 3 thyA Thymidylate synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q03LN3 6.76e-14 73 26 14 316 3 thyA Thymidylate synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M0S7 8.44e-14 73 26 14 316 3 thyA Thymidylate synthase Streptococcus thermophilus (strain CNRZ 1066)
C1CD36 1.23e-13 73 26 15 311 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain JJA)
B8ZMQ1 1.23e-13 73 26 15 311 3 thyA Thymidylate synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
A3CMU9 2.64e-13 72 25 14 313 3 thyA Thymidylate synthase Streptococcus sanguinis (strain SK36)
Q8DZ07 3.63e-13 72 25 12 317 3 thyA Thymidylate synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q02Y43 4e-13 71 25 13 313 3 thyA Thymidylate synthase Lactococcus lactis subsp. cremoris (strain SK11)
A8AXC2 4.71e-13 71 25 13 313 3 thyA Thymidylate synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8E4L6 1.29e-12 70 24 12 317 3 thyA Thymidylate synthase Streptococcus agalactiae serotype III (strain NEM316)
Q3K0J7 1.29e-12 70 24 12 317 3 thyA Thymidylate synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C3K3Q8 3.06e-12 69 23 12 328 3 thyA Thymidylate synthase Pseudomonas fluorescens (strain SBW25)
P19368 6.9e-12 68 25 11 311 3 thyA Thymidylate synthase Lactococcus lactis subsp. lactis (strain IL1403)
Q8DUI4 1.61e-11 67 25 13 314 3 thyA Thymidylate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0DG67 2.21e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG66 2.21e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67051 2.21e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M1
Q48U25 2.59e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF20 2.59e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J744 2.59e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHC5 2.59e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8P1D1 2.59e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCM3 2.59e-11 66 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q1JM80 3.98e-11 65 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC96 3.98e-11 65 25 15 313 3 thyA Thymidylate synthase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P31654 6.69e-08 57 33 4 126 1 None Deoxyuridylate hydroxymethyltransferase Bacillus phage SP01
O26868 1.18e-07 55 30 2 122 3 thyA Putative thymidylate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P0C0M4 1.3e-07 52 28 2 103 3 thyA Thymidylate synthase (Fragment) Staphylococcus epidermidis
P80305 8.82e-06 49 26 2 131 1 thyA Putative thymidylate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q46E28 1.4e-05 48 25 0 110 3 thyA Putative thymidylate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8THH4 0.000123 46 23 0 110 3 thyA Putative thymidylate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q12X17 0.000124 46 28 2 115 3 thyA Putative thymidylate synthase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P0DTK3 0.00017 46 32 3 108 1 None Deoxyuridylate hydroxymethyltransferase Pseudomonas phage M6

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_09235
Feature type CDS
Gene thyA
Product thymidylate synthase
Location 66396 - 67331 (strand: 1)
Length 936 (nucleotides) / 311 (amino acids)
In genomic island -

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_256
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00303 Thymidylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0207 Nucleotide transport and metabolism (F) F Thymidylate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MEQYLDIAKRILEEGKWIENKRTGKRCLTIINADFTYHVDKNEFPLVTTRKAFWKAAIAEMLGYLRGYDSAAQFRAIGCNTWNANANENTDWLANPNRKGEDDMGRVYGVQGRQLKVSPTEAQYDLLLSLNDSGDKEGVKTLINELRKNTFDQLRKVYDNLKKGIDDRGEIISFWNPGEFNQGCLRPCMFMHHFSVLDGTLYLNSYQRSCDYALGYVFNAPQCYFLLAIMAQITGLKCGKVYHKVVNLHLYEDQLELMRDVQIARKPFASPKLHINPDIKTLDDLMTWVTTDDFTVTDYQHHDPIKYPFSV

Flanking regions ( +/- flanking 50bp)

AATAATGTTATAATATAAAAACCATATACTGCGTCAACAGGAAAACGAAAGTGGAACAATATTTAGACATTGCAAAGCGGATTCTGGAGGAAGGGAAATGGATTGAGAATAAACGGACAGGTAAAAGATGCCTGACAATTATTAATGCCGATTTCACTTACCACGTTGACAAAAATGAGTTCCCGCTGGTGACCACCCGCAAGGCATTCTGGAAAGCCGCAATTGCAGAGATGCTGGGTTACTTACGCGGATATGACAGCGCCGCTCAGTTCAGAGCCATCGGCTGTAATACCTGGAACGCTAACGCCAATGAAAATACCGACTGGCTGGCAAACCCGAACCGCAAAGGTGAGGATGATATGGGTCGCGTTTATGGTGTTCAGGGACGGCAGCTGAAAGTATCCCCGACAGAAGCACAGTATGATTTATTATTATCATTAAATGATTCCGGAGATAAAGAAGGTGTTAAAACACTGATTAATGAACTGCGAAAAAATACATTCGATCAACTCCGTAAAGTCTATGATAATTTAAAAAAAGGAATTGATGACCGCGGTGAAATTATTTCATTCTGGAATCCCGGTGAATTTAATCAGGGTTGCCTGAGACCCTGCATGTTTATGCATCATTTCTCCGTTCTTGATGGCACATTATATTTAAACAGTTATCAGCGCAGTTGTGATTATGCACTGGGTTATGTTTTCAATGCGCCGCAATGTTATTTCCTGCTGGCTATTATGGCTCAGATAACCGGCCTGAAATGCGGTAAGGTTTATCACAAAGTGGTTAACCTTCATTTATATGAAGATCAGCTGGAATTAATGCGTGATGTCCAGATTGCACGTAAGCCATTTGCATCACCGAAACTGCATATTAACCCTGACATTAAAACGCTGGATGATTTAATGACATGGGTAACCACCGATGACTTCACAGTGACAGATTATCAGCACCACGACCCGATTAAATATCCGTTCTCTGTCTGAGAAACCATTAAACAGCCGCGCATAAAAAAACTGCATCCGTTACGATGCAG