Homologs in group_68

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10590 FBDBKF_10590 89.8 Morganella morganii S1 atoC acetoacetate metabolism transcriptional regulator AtoC
FBDBKF_12110 FBDBKF_12110 44.8 Morganella morganii S1 glnG nitrogen regulation protein NR(I)
EHELCC_14195 EHELCC_14195 44.8 Morganella morganii S2 glnG nitrogen regulation protein NR(I)
EHELCC_14925 EHELCC_14925 89.8 Morganella morganii S2 atoC acetoacetate metabolism transcriptional regulator AtoC
NLDBIP_14755 NLDBIP_14755 89.8 Morganella morganii S4 atoC acetoacetate metabolism transcriptional regulator AtoC
NLDBIP_15290 NLDBIP_15290 44.8 Morganella morganii S4 glnG nitrogen regulation protein NR(I)
LHKJJB_14590 LHKJJB_14590 89.8 Morganella morganii S3 atoC acetoacetate metabolism transcriptional regulator AtoC
LHKJJB_15320 LHKJJB_15320 44.8 Morganella morganii S3 glnG nitrogen regulation protein NR(I)
HKOGLL_13210 HKOGLL_13210 89.8 Morganella morganii S5 atoC acetoacetate metabolism transcriptional regulator AtoC
HKOGLL_14440 HKOGLL_14440 44.8 Morganella morganii S5 glnG nitrogen regulation protein NR(I)
F4V73_RS14530 F4V73_RS14530 44.4 Morganella psychrotolerans glnG nitrogen regulation protein NR(I)
PMI_RS14255 PMI_RS14255 44.4 Proteus mirabilis HI4320 glnG nitrogen regulation protein NR(I)

Distribution of the homologs in the orthogroup group_68

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_68

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q06065 0.0 607 65 2 460 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P14375 8.91e-131 388 45 6 454 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8X613 3.24e-130 387 45 7 454 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P25852 7.09e-129 383 44 4 453 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 4.3e-128 381 44 4 453 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q9APD9 2.78e-127 379 45 5 455 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P0AFB8 4.83e-121 364 43 6 469 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 4.83e-121 364 43 6 469 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P28787 1.45e-120 363 43 5 470 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P41789 1.63e-120 363 43 6 469 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P03029 6.1e-120 361 43 4 467 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q9I4N3 1.47e-108 332 40 3 470 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q00934 3.5e-107 328 40 2 454 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KT84 2.89e-105 323 38 4 452 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P10577 2.31e-104 322 38 8 483 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q9HU19 2.81e-104 321 40 3 454 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7MM78 4.66e-102 315 38 4 456 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 4.66e-102 315 38 4 456 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q87MX7 1.23e-101 314 39 7 454 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0C5S5 4.04e-101 312 38 6 454 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 4.04e-101 312 38 6 454 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P45671 4.94e-99 308 37 6 479 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P23747 6.98e-99 306 42 1 376 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88AQ2 3.52e-98 305 39 5 462 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88RJ6 4.32e-98 305 38 5 457 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0AFU5 2.53e-97 302 38 6 455 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 2.53e-97 302 38 6 455 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q04848 1.02e-96 302 36 3 474 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P27713 1.93e-96 303 44 3 376 4 nifA Nif-specific regulatory protein Herbaspirillum seropedicae
P12627 6.54e-96 301 47 1 327 1 vnfA Nitrogen fixation protein VnfA Azotobacter vinelandii
P10576 5.32e-94 295 35 5 475 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P12626 7.19e-94 296 45 1 334 4 anfA Nitrogen fixation protein AnfA Azotobacter vinelandii
P10046 1.52e-93 293 37 4 453 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P13632 3.08e-93 292 35 2 452 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P17899 2.77e-92 290 42 4 387 4 flbD Transcriptional regulatory protein FlbD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P29267 3.48e-92 290 36 8 487 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q04849 1.11e-88 280 33 5 464 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P09570 2.19e-88 282 45 5 337 4 nifA Nif-specific regulatory protein Azotobacter vinelandii
G3XCV0 2.69e-86 275 37 10 495 1 fleQ Transcriptional regulator FleQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P71229 4.75e-86 280 54 1 258 1 hyfR DNA-binding transcriptional activator HyfR Escherichia coli (strain K12)
P54930 1.73e-84 271 45 5 329 4 nifA Nif-specific regulatory protein Enterobacter agglomerans
P56266 3.2e-84 271 45 5 327 3 nifA Nif-specific regulatory protein Klebsiella oxytoca
P03027 3.41e-84 271 46 4 314 1 nifA Nif-specific regulatory protein Klebsiella pneumoniae
P54929 1.76e-83 272 54 1 242 4 nifA Nif-specific regulatory protein Azospirillum lipoferum
P30667 3.48e-83 271 54 1 242 1 nifA Nif-specific regulatory protein Azospirillum brasilense
P31908 5.42e-83 267 36 6 474 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P05407 4.95e-81 265 43 5 346 1 nifA Nif-specific regulatory protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
E1WAA4 5.27e-81 267 45 5 323 3 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain SL1344)
P0CL46 8.64e-81 266 45 5 323 1 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3K999 4.47e-80 255 42 4 338 3 sfnR Sigma54-dependent transcriptional regulator SfnR Pseudomonas fluorescens (strain Pf0-1)
Q53206 4.87e-80 262 41 8 354 4 nifA Nif-specific regulatory protein Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P24426 5.59e-80 254 54 1 225 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum bv. trifolii
P38022 7.85e-80 258 40 3 328 1 rocR Transcriptional activator RocR Bacillus subtilis (strain 168)
P19323 8.35e-80 264 44 4 322 1 fhlA Formate hydrogenlyase transcriptional activator FhlA Escherichia coli (strain K12)
A8ANR6 2.43e-79 258 45 2 313 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P09133 4.76e-79 260 55 2 247 2 nifA Nif-specific regulatory protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
O25408 6.05e-79 253 39 7 387 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
Q845S7 1.22e-78 251 42 2 323 2 sfnR Sigma54-dependent transcriptional activator SfnR Pseudomonas putida
D5ARW9 1.23e-77 255 52 1 238 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CY94 1.45e-77 255 52 1 238 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus
Q43965 1.6e-77 254 40 4 347 1 mopR Phenol regulator MopR Acinetobacter guillouiae
O85057 1.12e-76 252 43 7 322 1 None Limonene hydroxylase Geobacillus stearothermophilus
P54529 1.99e-75 252 40 7 358 4 yqiR Putative sigma L-dependent transcriptional regulator YqiR Bacillus subtilis (strain 168)
P06519 2.61e-75 249 42 3 318 4 xylR Transcriptional regulatory protein XylR Pseudomonas putida
Q8D4F9 5.18e-75 247 41 5 336 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain CMCP6)
Q4UL27 1.43e-74 244 31 9 457 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B5FSZ0 1.68e-74 245 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella dublin (strain CT_02021853)
C0PWN2 1.96e-74 245 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi C (strain RKS4594)
Q7MFY9 2.63e-74 245 44 4 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain YJ016)
P26047 2.64e-74 248 40 5 343 4 stc Signal-transduction and transcriptional-control protein Clostridium beijerinckii
B5F363 5.05e-74 244 44 1 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella agona (strain SL483)
Q46802 5.51e-74 246 44 5 313 4 uacR Putative uric acid sigma-54-dependent transcriptional regulator UacR Escherichia coli (strain K12)
A9MFX7 6.38e-74 244 45 1 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z4C6 1.64e-73 243 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhi
A9N0D7 1.64e-73 243 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5QV88 1.64e-73 243 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella enteritidis PT4 (strain P125109)
Q57KT4 1.64e-73 243 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella choleraesuis (strain SC-B67)
Q5PF20 1.66e-73 243 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZMJ8 1.73e-73 243 44 1 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TT16 1.73e-73 243 44 1 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella schwarzengrund (strain CVM19633)
B5RDG4 1.79e-73 243 44 3 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella gallinarum (strain 287/91 / NCTC 13346)
P09828 2.35e-73 243 47 1 245 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum
A4WDR5 3.24e-73 242 44 4 301 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Enterobacter sp. (strain 638)
B4TF23 3.95e-73 242 44 1 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella heidelberg (strain SL476)
Q9ZCY9 1.02e-72 239 30 8 456 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q68WH4 2.87e-72 238 30 9 457 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B4T3B0 3.29e-72 239 44 1 302 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella newport (strain SL254)
P03028 5.66e-72 239 44 6 329 4 nifA Nif-specific regulatory protein Rhizobium meliloti (strain 1021)
B5Z370 5.8e-72 238 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X854 5.8e-72 238 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O157:H7
P37013 6.87e-72 238 43 4 312 1 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12)
B1XCN6 6.87e-72 238 43 4 312 2 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12 / DH10B)
C4ZYV4 6.87e-72 238 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12 / MC4100 / BW2952)
Q01265 7.44e-72 232 43 4 278 4 None Uncharacterized protein in HyuA 5'region (Fragment) Pseudomonas sp. (strain NS671)
B6I695 9.84e-72 238 44 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SE11)
P59402 1.06e-71 238 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella flexneri
Q0T1D4 1.06e-71 238 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella flexneri serotype 5b (strain 8401)
Q32CL9 1.28e-71 238 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella dysenteriae serotype 1 (strain Sd197)
A7ZQD8 1.59e-71 237 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LQ27 2.09e-71 237 44 4 307 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SMS-3-5 / SECEC)
B7MZ04 2.63e-71 237 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O81 (strain ED1a)
P54931 2.9e-71 239 48 1 238 4 nifA Nif-specific regulatory protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8FEN6 3.06e-71 237 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LEC0 3.12e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain 55989 / EAEC)
Q1R7Z1 3.29e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain UTI89 / UPEC)
A1AEP9 3.29e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O1:K1 / APEC
B7MKH8 3.29e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHC1 3.7e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4STH5 5.27e-71 236 42 2 306 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas salmonicida (strain A449)
Q3YYF5 7.67e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella sonnei (strain Ss046)
Q0TEH1 8.09e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7M9E6 8.53e-71 236 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O8 (strain IAI1)
Q31X73 8.62e-71 235 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella boydii serotype 4 (strain Sb227)
Q1RJS1 9.32e-71 234 30 7 457 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
B1IUX0 9.48e-71 235 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3I6 1.15e-70 235 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O9:H4 (strain HS)
B7N6T9 1.79e-70 234 43 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NSI9 2.28e-70 234 43 4 307 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A0KEJ0 2.54e-70 234 42 3 311 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A6TCX4 6.58e-70 233 44 2 297 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LW25 8.03e-70 233 43 4 307 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5XVA2 1.62e-69 233 43 2 297 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae (strain 342)
P74839 1.78e-69 233 41 8 338 4 prpR Propionate catabolism operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5E3W8 2.68e-69 232 41 4 312 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q92HC2 7.95e-69 229 32 10 458 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q6D8R9 1.41e-68 230 42 5 310 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P77743 2.5e-68 229 43 11 339 1 prpR Propionate catabolism operon regulatory protein Escherichia coli (strain K12)
O31551 2.57e-68 231 35 6 390 2 acoR Acetoin dehydrogenase operon transcriptional activator AcoR Bacillus subtilis (strain 168)
P37344 4.54e-67 220 42 6 320 1 pspF Psp operon transcriptional activator Escherichia coli (strain K12)
Q9ZIB7 2.16e-66 224 38 4 320 1 tyrR HTH-type transcriptional regulatory protein TyrR Enterobacter agglomerans
A8GG93 3.14e-66 224 41 3 304 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Serratia proteamaculans (strain 568)
Q9KN48 6.83e-66 223 36 6 362 4 vasH Transcriptional regulator VasH Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P07604 5.07e-65 221 36 5 333 1 tyrR HTH-type transcriptional regulatory protein TyrR Escherichia coli (strain K12)
O87455 5.35e-65 221 39 6 347 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P37931 9.01e-65 214 41 4 297 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas syringae pv. syringae
O54426 6.78e-63 215 36 5 333 3 tyrR HTH-type transcriptional regulatory protein TyrR Citrobacter braakii
P0A2D7 4.02e-62 213 36 6 335 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D8 4.02e-62 213 36 6 335 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhi
Q9K4U8 1.52e-61 211 35 5 377 2 norR2 Nitric oxide reductase transcription regulator NorR2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P28614 1.62e-59 209 39 6 303 1 acoR Acetoin catabolism regulatory protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9K4V0 3.43e-59 205 41 3 291 2 norR1 Nitric oxide reductase transcription regulator NorR1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P26316 4.81e-59 199 38 4 298 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas savastanoi pv. phaseolicola
P37930 2.73e-55 189 38 4 290 4 hrpR Pathogenicity locus probable regulatory protein HrpR Pseudomonas syringae pv. syringae
P26408 2.99e-54 191 29 7 476 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
P36219 2.77e-51 179 36 3 300 4 wtsA Pathogenicity locus probable regulatory protein WtsA Pantoea stewartii subsp. stewartii
P09432 1.26e-50 181 28 8 479 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P44694 3.92e-45 162 34 4 314 1 tyrR HTH-type transcriptional regulatory protein TyrR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38035 6.38e-41 156 34 6 294 4 rtcR Transcriptional regulatory protein RtcR Escherichia coli (strain K12)
P45512 2.97e-36 144 29 4 328 4 dhaR Glycerol metabolism operon regulatory protein Citrobacter freundii
P76016 1.22e-35 142 30 7 342 1 dhaR PTS-dependent dihydroxyacetone kinase operon regulatory protein Escherichia coli (strain K12)
P54156 2.37e-35 137 37 5 236 2 yplP Putative sigma L-dependent transcriptional regulator YplP Bacillus subtilis (strain 168)
P55610 1.14e-31 131 28 4 336 4 NGR_a02110 Putative transcriptional regulatory protein y4pA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P06184 4e-31 127 25 11 447 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O69730 1.79e-24 104 43 0 106 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P28835 2.29e-24 104 41 1 116 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
O78428 9.2e-24 103 44 1 116 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P48259 6.88e-23 100 42 1 119 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P28257 3.25e-22 99 42 1 116 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P51358 3.31e-22 98 40 1 116 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 3.38e-22 98 40 1 116 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q9TLQ4 6.86e-21 95 42 1 119 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P06628 2.1e-20 90 37 0 118 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P13792 1.62e-19 90 37 0 120 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
L7N689 7.26e-19 89 32 3 168 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P52942 7.86e-19 85 34 0 118 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
A1TEL7 2.58e-18 87 37 0 107 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
D0ZLR9 2.6e-18 91 37 8 183 2 dgaR Transcriptional regulatory protein DagR Salmonella typhimurium (strain 14028s / SGSC 2262)
A1KHB7 2.81e-18 87 30 3 170 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 2.81e-18 87 30 3 170 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0PWB4 3.55e-18 86 32 3 160 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P9WGM9 4.22e-18 86 30 3 170 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 4.22e-18 86 30 3 170 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 4.22e-18 86 30 3 170 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q1B3X8 8.31e-18 85 37 0 107 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 8.31e-18 85 37 0 107 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 8.31e-18 85 37 0 107 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q8DPL7 8.47e-18 85 37 1 108 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 8.47e-18 85 37 1 108 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 8.47e-18 85 37 1 108 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0QTK2 9.97e-18 85 37 1 108 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q742C1 1.08e-17 85 33 3 158 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.08e-17 85 33 3 158 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A0R3I8 1.14e-17 85 35 0 109 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CD68 2e-17 84 36 0 107 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P9WGM7 2.16e-17 84 37 1 106 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 2.16e-17 84 37 1 106 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 2.16e-17 84 37 1 106 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 3.02e-17 84 38 1 102 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9CCJ2 3.36e-17 84 38 1 102 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P37478 4.07e-17 84 37 1 118 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q7A216 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 4.75e-17 83 39 1 107 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 4.75e-17 83 39 1 107 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 4.75e-17 83 39 1 107 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 4.75e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CQK0 4.84e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 4.84e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 6.28e-17 83 39 1 107 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q9AE24 7.66e-17 83 35 0 116 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q4A160 1.84e-16 82 34 2 134 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P23914 3.47e-16 85 32 4 159 3 levR Transcriptional regulatory protein LevR Bacillus subtilis (strain 168)
Q55890 5.27e-16 80 34 1 109 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7D9K0 5.6e-16 80 38 0 107 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 5.6e-16 80 38 0 107 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P43501 5.77e-16 77 44 2 105 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P24072 6.13e-16 77 35 1 105 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
O34903 1.01e-15 79 35 0 122 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q8CQ17 1.48e-15 79 36 1 109 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 1.48e-15 79 36 1 109 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0CL17 1.76e-15 79 33 1 151 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1.76e-15 79 33 1 151 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q7A1J1 2.27e-15 78 35 1 115 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 2.27e-15 78 35 1 115 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 2.27e-15 78 35 1 115 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 2.27e-15 78 35 1 115 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 2.27e-15 78 35 1 115 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 2.27e-15 78 35 1 115 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 2.27e-15 78 35 1 115 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 2.27e-15 78 35 1 115 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 2.27e-15 78 35 1 115 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 2.27e-15 78 35 1 115 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q2FWH6 2.93e-15 78 30 1 127 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q56312 7.47e-15 74 34 1 103 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P45337 1.33e-14 76 35 0 107 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96602 1.36e-14 76 32 3 136 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q9F868 1.37e-14 76 38 1 106 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WGM1 1.39e-14 76 36 0 93 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.39e-14 76 36 0 93 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.39e-14 76 36 0 93 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P54443 1.5e-14 76 32 2 125 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P52931 1.62e-14 75 30 4 152 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P42244 3.29e-14 75 34 2 131 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P96126 3.54e-14 73 35 2 120 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q50136 4.53e-14 75 36 0 93 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P9WGM3 4.73e-14 74 31 3 136 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 4.73e-14 74 31 3 136 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q47456 5.25e-14 74 36 0 107 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q49XM7 5.3e-14 74 33 1 121 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q04803 6.18e-14 75 37 1 113 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q31S42 7.86e-14 74 32 1 109 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P45709 8.37e-14 71 36 3 120 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P52928 1.1e-13 74 37 2 111 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P9WGN1 1.16e-13 73 31 2 127 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 1.16e-13 73 31 2 127 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P23221 1.16e-13 73 30 1 139 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9ZEP4 1.4e-13 73 36 1 102 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P23620 1.68e-13 73 34 1 108 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WGL9 1.74e-13 73 38 1 106 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 1.74e-13 73 38 1 106 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 1.74e-13 73 38 1 106 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O31432 1.98e-13 72 31 2 119 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P0A4I0 2.09e-13 72 34 0 107 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 2.09e-13 72 34 0 107 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q82EB1 2.26e-13 72 36 1 102 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q02540 2.66e-13 72 33 3 139 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P39486 2.79e-13 72 28 3 142 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q9HUI2 3.06e-13 72 37 4 122 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A4I4 4.4e-13 72 36 2 111 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 4.4e-13 72 36 2 111 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P35163 4.93e-13 72 33 2 127 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q99U73 5.16e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P0C001 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 5.9e-13 71 31 1 126 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 5.9e-13 71 31 1 126 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P51586 1.14e-12 68 32 1 122 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P10958 1.26e-12 70 33 0 115 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P0ACZ8 1.6e-12 70 32 0 107 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.6e-12 70 32 0 107 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.6e-12 70 32 0 107 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
B8GZM2 1.92e-12 72 30 2 142 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 1.92e-12 72 30 2 142 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9HV32 2.61e-12 69 28 7 211 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42421 2.96e-12 69 34 2 118 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P0DM78 3.01e-12 69 31 0 107 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 3.01e-12 69 31 0 107 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 3.01e-12 69 31 0 107 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 3.01e-12 69 31 0 107 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 3.01e-12 69 31 0 107 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z7H2 3.04e-12 69 31 0 107 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q4L6C6 3.72e-12 68 31 1 125 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q83RR0 6.49e-12 68 30 0 107 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 6.49e-12 68 30 0 107 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9ZHD3 7.94e-12 68 32 0 107 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P23836 8.23e-12 68 30 0 107 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
P21866 1.02e-11 67 33 1 115 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q07783 1.02e-11 68 33 2 112 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q44006 1.15e-11 67 29 2 151 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0A4H5 1.16e-11 65 33 1 103 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.16e-11 65 33 1 103 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8CN92 1.17e-11 67 33 2 135 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P06534 1.19e-11 68 32 3 113 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q5HLN2 1.27e-11 67 33 2 135 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q57QC3 1.35e-11 67 30 0 107 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q9I4F9 1.6e-11 67 30 0 108 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45607 1.78e-11 67 33 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P50350 1.91e-11 67 32 2 112 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q8X738 2e-11 67 30 0 107 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P45606 2.05e-11 67 33 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 2.15e-11 67 33 1 109 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 2.15e-11 67 33 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P42012 2.28e-11 67 33 3 113 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q04942 2.54e-11 66 30 1 101 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P50351 2.61e-11 67 32 2 112 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B0R4K1 2.64e-11 63 33 0 102 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
A6WZ81 3.57e-11 66 28 0 107 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FZ93 3.64e-11 66 28 0 107 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 3.64e-11 66 28 0 107 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 3.64e-11 66 28 0 107 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 3.64e-11 66 28 0 107 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 3.64e-11 66 28 0 107 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 3.64e-11 66 28 0 107 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 3.64e-11 66 28 0 107 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 3.64e-11 66 28 0 107 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P94504 3.95e-11 66 31 2 123 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q7A0U4 4.46e-11 66 30 1 118 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 4.46e-11 66 30 1 118 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 4.46e-11 66 30 1 118 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 4.46e-11 66 30 1 118 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 4.46e-11 66 30 1 118 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 4.46e-11 66 30 1 118 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 4.46e-11 66 30 1 118 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 4.46e-11 66 30 1 118 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P0A4H8 5.12e-11 65 32 1 116 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 5.12e-11 65 32 1 116 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P52940 5.3e-11 66 35 4 108 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
O05251 5.91e-11 65 30 3 133 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q8XBS3 6.36e-11 65 32 0 107 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P0DMK7 6.42e-11 65 36 1 107 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 6.42e-11 65 36 1 107 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q9I0I1 7.5e-11 65 31 0 116 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q01473 7.51e-11 68 31 3 150 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 1.23e-07 57 27 1 118 3 rcaC Protein RcaC Microchaete diplosiphon
P45189 7.61e-11 65 33 2 104 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O32192 7.95e-11 65 32 1 119 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q0AYL3 8.28e-11 67 31 4 129 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
T2KMF4 8.31e-11 68 34 3 117 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q9WY30 8.73e-11 67 31 1 115 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P69228 8.96e-11 65 29 4 159 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 8.96e-11 65 29 4 159 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O25918 9.27e-11 64 30 1 114 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q10WZ6 9.31e-11 66 34 4 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
B8H358 1.05e-10 65 27 0 107 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.05e-10 65 27 0 107 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9K998 1.06e-10 65 30 4 130 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q65JK6 1.14e-10 66 32 6 132 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A0A0H3GGB5 1.16e-10 65 39 2 107 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q0AWZ8 1.16e-10 66 41 3 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P52932 1.2e-10 64 32 3 114 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q9KL96 1.23e-10 65 34 3 120 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1SMR4 1.32e-10 66 36 3 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P0AEV3 1.36e-10 66 31 1 116 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.36e-10 66 31 1 116 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.36e-10 66 31 1 116 3 rssB Regulator of RpoS Escherichia coli O157:H7
P52934 1.36e-10 65 33 2 112 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
A0QTU7 1.39e-10 67 22 9 317 4 mimR Propane 2-monooxygenase operon transcriptional activator MimR Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P46384 1.4e-10 62 29 1 109 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDE4 1.43e-10 64 23 4 189 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q8D4U6 1.54e-10 65 37 4 116 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
P33112 1.57e-10 64 33 3 118 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q8F6P9 1.77e-10 65 30 7 165 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62641 1.77e-10 65 30 7 165 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P52941 1.82e-10 64 29 3 112 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8RAZ3 1.85e-10 65 30 8 191 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6QJK3 1.97e-10 63 31 1 116 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.97e-10 63 31 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q1IQS9 2.23e-10 65 39 5 120 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
P66795 2.36e-10 63 32 1 118 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 2.36e-10 63 32 1 118 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P39663 2.44e-10 64 28 1 120 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8KR08 2.44e-10 63 28 0 135 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q6GK93 2.47e-10 64 29 3 117 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
P26275 2.54e-10 64 35 4 123 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2YV56 2.59e-10 64 29 3 117 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NYJ9 2.66e-10 64 29 3 117 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 2.66e-10 64 29 3 117 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 2.66e-10 64 29 3 117 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 2.66e-10 64 29 3 117 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 2.66e-10 64 29 3 117 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q06239 3.11e-10 63 28 1 109 3 vanR Regulatory protein VanR Enterococcus faecium
Q97GZ3 3.34e-10 65 25 5 187 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P45605 3.39e-10 63 32 1 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q70FH0 3.99e-10 63 36 1 115 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
P52076 4.08e-10 63 31 0 107 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P58253 4.24e-10 63 30 4 113 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1IRH0 4.47e-10 64 39 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P55184 4.58e-10 62 34 5 109 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
Q52990 4.62e-10 63 31 2 120 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P32040 4.78e-10 63 30 3 120 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P44895 4.8e-10 63 39 2 107 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44929 4.87e-10 63 31 2 125 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P0AE90 4.95e-10 63 37 2 107 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 4.95e-10 63 37 2 107 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 4.95e-10 63 37 2 107 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P94413 5.17e-10 62 30 1 102 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q2YZ24 5.6e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P52929 5.77e-10 62 33 3 107 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P54884 5.95e-10 62 41 1 77 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q6GE73 6.1e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q9KQD5 6.22e-10 60 33 2 117 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 6.22e-10 60 33 2 117 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P52938 6.45e-10 63 33 4 121 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q9KA55 7.05e-10 63 32 4 132 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q55933 7.13e-10 62 33 2 118 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KM23 7.84e-10 62 37 3 108 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7A7X9 8.37e-10 62 29 3 117 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 8.37e-10 62 29 3 117 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6AJV3 8.55e-10 63 24 4 205 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P38889 8.74e-10 64 30 0 119 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7CQM8 8.75e-10 62 29 1 134 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7A039 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 8.79e-10 62 30 1 116 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P36556 8.88e-10 62 28 1 152 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q12YX1 9.24e-10 63 35 5 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P52936 1.01e-09 62 30 4 130 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9KS59 1.03e-09 63 36 4 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O06978 1.15e-09 62 33 1 105 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q9FXD6 1.15e-09 63 27 3 125 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q9K621 1.18e-09 62 26 1 103 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P48027 1.18e-09 64 31 1 113 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q54SP4 1.38e-09 64 29 3 135 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P0AEF7 1.38e-09 61 32 2 131 3 dpiA Transcriptional regulatory protein DpiA Shigella flexneri
P0AEF4 1.38e-09 61 32 2 131 1 dpiA Transcriptional regulatory protein DpiA Escherichia coli (strain K12)
P0AEF5 1.38e-09 61 32 2 131 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEF6 1.38e-09 61 32 2 131 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O157:H7
P0AFT5 1.38e-09 62 29 7 178 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 1.38e-09 62 29 7 178 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 1.38e-09 62 29 7 178 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 1.38e-09 62 29 7 178 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
O83639 1.42e-09 63 33 3 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q3LWR6 1.47e-09 61 25 0 123 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 1.47e-09 61 25 0 123 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 1.47e-09 61 25 0 123 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P59640 1.61e-09 61 29 7 178 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
A2XFB7 1.86e-09 63 31 2 117 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q4L8L9 1.86e-09 61 31 1 116 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q10N34 2.03e-09 63 31 2 117 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
Q8ZBV2 2.42e-09 61 33 4 115 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
P0A9Q4 2.42e-09 61 28 2 126 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.42e-09 61 28 2 126 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.42e-09 61 28 2 126 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.42e-09 61 28 2 126 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q5JF95 2.52e-09 62 30 5 136 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8D0P1 2.52e-09 58 30 2 117 3 cheY Chemotaxis protein CheY Yersinia pestis
Q47I43 2.73e-09 62 35 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
Q2IQS6 2.77e-09 62 34 4 110 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
A0A4P7TS68 3.09e-09 60 27 0 121 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 3.09e-09 60 27 0 121 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 3.09e-09 60 27 0 121 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 3.09e-09 60 27 0 121 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 3.09e-09 60 27 0 121 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 3.09e-09 60 27 0 121 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 3.09e-09 60 27 0 121 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 3.09e-09 60 27 0 121 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P44918 3.12e-09 60 29 3 141 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2WAJ8 3.14e-09 62 28 2 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
G3XGC1 3.18e-09 62 27 3 151 4 mimR Propane 2-monooxygenase operon transcriptional activator MimR Mycolicibacterium goodii
Q3ADA6 3.31e-09 62 36 3 113 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O85128 3.35e-09 62 33 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q67P67 3.62e-09 62 32 3 120 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q31HL9 3.71e-09 62 35 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5A4X5 4.7e-09 62 30 1 125 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q2YC79 5.21e-09 61 27 5 151 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P96686 5.36e-09 59 32 3 104 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q7NSI8 5.75e-09 61 32 5 134 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0D3B6 5.81e-09 62 30 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
Q54YZ9 6.07e-09 62 35 4 123 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q2RZD2 6.43e-09 61 35 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q07597 6.55e-09 59 29 2 109 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q8EQW0 6.66e-09 60 31 4 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q05522 6.82e-09 60 26 7 194 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
A2YQ93 7.04e-09 62 30 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q9UYF3 7.28e-09 60 29 4 134 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
E0X9C7 8.07e-09 62 29 3 134 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q3IRR4 8.3e-09 60 34 3 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P76340 8.89e-09 59 29 1 107 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q5V0B3 9.56e-09 60 32 5 128 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P37740 9.94e-09 58 33 1 107 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
Q9WYN9 1.09e-08 60 29 2 154 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14300
Feature type CDS
Gene atoC
Product acetoacetate metabolism transcriptional regulator AtoC
Location 81667 - 83052 (strand: 1)
Length 1386 (nucleotides) / 461 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_68
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00158 Sigma-54 interaction domain
PF02954 Bacterial regulatory protein, Fis family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2204 Signal transduction mechanisms (T) T DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07714 two-component system, NtrC family, response regulator AtoC Two-component system -

Protein Sequence

MITTKSYRILIVDDEKNLSQMLQTAFRIDGHDILTAGDGEAAVACFKQEQPDVVLMDIRMPKLDGIEALQQMRDINSGIPVILMTAYAAVETAVEALRLGAFDYVIKPFDLTELKLLISRALQLQEMKQEINLLHRELSASYQWGRMLTRNPKMMEICRDIAKVSRSQASVLITGESGTGKEVVARAIHYNSERAGGPFIKVNCGALPGSLLESELFGHEKGAFTGAQVQRQGLFERASGGTLLLDEVGEMPSDLQVKLLRVVQEKEFERVGGSNTIRVDLRIVAATNRDMDERVREGHFRRDLFYRLNVIHLNLPPLRERPEDIGLLASHFLQKFSQENNRDIIELAPETLALLTGYPWPGNVREISNVIERAVIMSTGFVIFPEDLPEQLLSQVRSQVTPLLPVMQEPGLNLKENIKAYEKELIISALAEYQNNKTHTASALGISRRALMYKLQEYNIE

Flanking regions ( +/- flanking 50bp)

TCATGGCACAACGTTCACAATAATGTTGCCGGTAACGCAGAGTAAGTACAATGATAACAACTAAATCTTACCGTATTCTGATTGTTGATGATGAAAAAAACCTGAGTCAGATGCTACAGACGGCTTTCCGGATTGACGGGCACGACATACTGACCGCCGGAGACGGCGAAGCTGCTGTGGCGTGTTTTAAACAAGAACAGCCTGATGTGGTGCTGATGGATATCCGTATGCCGAAACTGGATGGCATTGAGGCTCTCCAGCAAATGCGGGACATTAACTCAGGTATTCCTGTGATCCTGATGACAGCTTACGCGGCGGTGGAAACCGCCGTAGAGGCGCTGCGTCTGGGCGCATTTGATTATGTGATAAAACCCTTTGATTTAACGGAGCTTAAACTGCTTATCTCCCGCGCGTTGCAATTACAGGAGATGAAACAGGAAATTAACCTGCTGCACCGTGAGCTGAGTGCCAGCTATCAATGGGGAAGAATGCTGACCCGCAACCCGAAAATGATGGAGATTTGCCGCGATATCGCCAAAGTGTCCCGCAGCCAGGCCAGTGTATTAATTACAGGGGAAAGCGGGACAGGCAAAGAAGTGGTGGCGCGGGCGATTCATTACAACAGCGAACGGGCAGGCGGACCCTTTATTAAAGTAAATTGCGGGGCATTGCCCGGTTCTTTGCTGGAAAGTGAATTATTCGGCCATGAAAAAGGGGCATTTACCGGCGCTCAGGTTCAGCGGCAGGGACTGTTTGAACGGGCAAGCGGCGGCACATTGTTACTTGATGAAGTCGGCGAGATGCCATCAGATTTGCAGGTAAAATTACTGCGGGTGGTACAGGAAAAGGAATTTGAGCGGGTAGGCGGCAGTAACACTATCCGCGTGGATCTCCGCATTGTCGCCGCAACAAACCGGGATATGGATGAACGCGTGCGGGAAGGGCATTTCCGGCGGGATCTTTTCTACCGTCTGAATGTTATCCATTTAAATTTACCGCCCCTGCGTGAGCGCCCGGAGGATATCGGTTTACTGGCTTCCCATTTCTTACAGAAATTCAGTCAGGAGAACAACCGGGACATTATTGAGCTGGCGCCGGAAACACTGGCACTGCTGACGGGGTATCCGTGGCCCGGGAATGTGCGGGAAATTTCTAATGTGATTGAGCGGGCGGTTATTATGAGCACCGGTTTTGTTATTTTCCCGGAAGACCTGCCGGAACAACTGTTGTCACAGGTGAGAAGTCAGGTGACACCATTGCTGCCGGTCATGCAGGAGCCGGGGCTGAATTTAAAAGAAAACATCAAAGCCTATGAAAAAGAGCTGATTATTTCGGCGCTGGCAGAATATCAAAATAATAAGACACATACCGCATCTGCATTAGGGATCAGTCGCCGGGCATTAATGTATAAATTACAAGAATACAATATCGAATAATATAAAATATAATTATAAAAAAGCACGGAGATATAAATCATATATCCCGT