Homologs in group_2352

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18990 FBDBKF_18990 83.9 Morganella morganii S1 truD tRNA pseudouridine(13) synthase TruD
EHELCC_18735 EHELCC_18735 83.9 Morganella morganii S2 truD tRNA pseudouridine(13) synthase TruD
NLDBIP_18570 NLDBIP_18570 83.9 Morganella morganii S4 truD tRNA pseudouridine(13) synthase TruD
LHKJJB_18605 LHKJJB_18605 83.9 Morganella morganii S3 truD tRNA pseudouridine(13) synthase TruD
HKOGLL_18340 HKOGLL_18340 83.9 Morganella morganii S5 truD tRNA pseudouridine(13) synthase TruD
PMI_RS11035 PMI_RS11035 66.4 Proteus mirabilis HI4320 truD tRNA pseudouridine(13) synthase TruD

Distribution of the homologs in the orthogroup group_2352

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2352

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F225 4.97e-166 469 66 0 344 3 truD tRNA pseudouridine synthase D Proteus mirabilis (strain HI4320)
A1JJT6 5.94e-165 467 65 0 345 3 truD tRNA pseudouridine synthase D Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJF6 6.7e-165 467 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EC1 6.7e-165 467 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FLX6 6.7e-165 467 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TPZ9 1.06e-164 466 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pestis (strain Pestoides F)
Q1CLR4 1.06e-164 466 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pestis bv. Antiqua (strain Nepal516)
A9R117 1.06e-164 466 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBP8 1.06e-164 466 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pestis
Q1C476 1.06e-164 466 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pestis bv. Antiqua (strain Antiqua)
B2K579 1.7e-164 466 66 0 333 3 truD tRNA pseudouridine synthase D Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A8G9Z4 1.14e-160 456 66 0 333 3 truD tRNA pseudouridine synthase D Serratia proteamaculans (strain 568)
Q6D1B5 5.9e-160 454 65 0 340 3 truD tRNA pseudouridine synthase D Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DDG0 3.36e-159 452 64 0 336 3 truD tRNA pseudouridine synthase D Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7N8K5 1.28e-158 451 63 0 332 3 truD tRNA pseudouridine synthase D Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VFZ5 2.02e-149 427 63 1 331 3 truD tRNA pseudouridine synthase D Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6TD37 3.48e-147 422 61 0 339 3 truD tRNA pseudouridine synthase D Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8ZMF8 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TTV9 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella schwarzengrund (strain CVM19633)
B5BEY2 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella paratyphi A (strain AKU_12601)
C0PXA5 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella paratyphi C (strain RKS4594)
A9N2D1 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEG3 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TFW5 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella heidelberg (strain SL476)
B5RDQ1 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW16 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella enteritidis PT4 (strain P125109)
B5FTS3 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella dublin (strain CT_02021853)
B5F409 5.81e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella agona (strain SL483)
A9MF30 6.28e-147 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z473 1.05e-146 421 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella typhi
B4T455 3.69e-146 419 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella newport (strain SL254)
Q57KJ6 6.03e-146 419 60 0 340 3 truD tRNA pseudouridine synthase D Salmonella choleraesuis (strain SC-B67)
A8ANV9 6.16e-146 419 60 0 340 3 truD tRNA pseudouridine synthase D Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1IUT4 3.82e-145 417 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3M4 3.82e-145 417 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O9:H4 (strain HS)
Q1R7U6 4.36e-145 416 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain UTI89 / UPEC)
A1AET9 4.36e-145 416 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O1:K1 / APEC
B7MKL9 4.36e-145 416 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LXF7 5.13e-145 416 60 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O8 (strain IAI1)
Q8FEJ7 5.98e-145 416 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3YYB7 1.07e-144 416 59 0 340 3 truD tRNA pseudouridine synthase D Shigella sonnei (strain Ss046)
Q57261 1.37e-144 415 59 0 340 1 truD tRNA pseudouridine synthase D Escherichia coli (strain K12)
B1XCS1 1.37e-144 415 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain K12 / DH10B)
C4ZZP9 1.37e-144 415 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZQI9 1.37e-144 415 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LWL0 1.4e-144 415 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I6D5 2.2e-144 415 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain SE11)
B7N6X5 2.32e-144 414 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NT89 2.45e-144 414 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32CI5 2.73e-144 414 59 0 340 3 truD tRNA pseudouridine synthase D Shigella dysenteriae serotype 1 (strain Sd197)
Q31XA7 3.02e-144 414 59 0 340 3 truD tRNA pseudouridine synthase D Shigella boydii serotype 4 (strain Sb227)
B1LQ65 3.05e-144 414 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain SMS-3-5 / SECEC)
C5BGI9 4.04e-144 414 62 0 333 3 truD tRNA pseudouridine synthase D Edwardsiella ictaluri (strain 93-146)
Q0TEB3 5.94e-144 414 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83QE3 8.61e-144 413 59 0 340 3 truD tRNA pseudouridine synthase D Shigella flexneri
B5Z3A7 1.06e-143 413 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7Y6 1.06e-143 413 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O157:H7
B7MZ46 1.44e-143 412 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O81 (strain ED1a)
B7LEG3 1.68e-143 412 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli (strain 55989 / EAEC)
Q0T1H6 1.73e-143 412 59 0 340 3 truD tRNA pseudouridine synthase D Shigella flexneri serotype 5b (strain 8401)
B2TZI6 1.83e-143 412 59 0 340 3 truD tRNA pseudouridine synthase D Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7UHG4 2.2e-143 412 59 0 340 3 truD tRNA pseudouridine synthase D Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4WDV0 1.05e-142 410 59 0 340 3 truD tRNA pseudouridine synthase D Enterobacter sp. (strain 638)
B5XV36 1.72e-141 407 60 0 339 3 truD tRNA pseudouridine synthase D Klebsiella pneumoniae (strain 342)
A7MJ59 3.13e-138 399 57 1 345 3 truD tRNA pseudouridine synthase D Cronobacter sakazakii (strain ATCC BAA-894)
Q0I5H8 3.44e-110 327 48 4 335 3 truD tRNA pseudouridine synthase D Histophilus somni (strain 129Pt)
B0URU7 7.45e-110 326 48 4 335 3 truD tRNA pseudouridine synthase D Histophilus somni (strain 2336)
Q65Q80 4.43e-106 317 48 3 337 3 truD tRNA pseudouridine synthase D Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CKK4 1.12e-105 316 47 4 341 3 truD tRNA pseudouridine synthase D Pasteurella multocida (strain Pm70)
A4SRB7 1.39e-104 313 50 4 336 3 truD tRNA pseudouridine synthase D Aeromonas salmonicida (strain A449)
Q4QML9 2.29e-103 310 49 3 326 3 truD tRNA pseudouridine synthase D Haemophilus influenzae (strain 86-028NP)
P44039 2.91e-103 310 50 3 326 1 truD tRNA pseudouridine synthase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UE25 7.65e-103 309 49 3 326 3 truD tRNA pseudouridine synthase D Haemophilus influenzae (strain PittEE)
A0KGH7 1.37e-102 308 49 4 334 3 truD tRNA pseudouridine synthase D Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A6VR02 3.09e-101 305 46 4 338 3 truD tRNA pseudouridine synthase D Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q15P29 1e-95 291 43 4 337 3 truD tRNA pseudouridine synthase D Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q6LMT5 5.49e-94 286 45 4 334 3 truD tRNA pseudouridine synthase D Photobacterium profundum (strain SS9)
Q5E330 1.18e-91 281 44 4 337 3 truD tRNA pseudouridine synthase D Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8EBR4 1.46e-91 281 44 4 333 3 truD tRNA pseudouridine synthase D Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B5FAF5 2.04e-91 280 44 4 337 3 truD tRNA pseudouridine synthase D Aliivibrio fischeri (strain MJ11)
Q487E7 3.39e-91 280 44 3 345 3 truD tRNA pseudouridine synthase D Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8DC58 9.49e-89 273 44 4 336 3 truD tRNA pseudouridine synthase D Vibrio vulnificus (strain CMCP6)
Q7MHQ6 1.53e-88 273 44 4 336 3 truD tRNA pseudouridine synthase D Vibrio vulnificus (strain YJ016)
Q87LQ4 3.56e-88 271 43 4 336 3 truD tRNA pseudouridine synthase D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EKL4 1.15e-87 270 42 4 335 3 truD tRNA pseudouridine synthase D Aliivibrio salmonicida (strain LFI1238)
A7MTT9 3.64e-86 266 43 5 336 3 truD tRNA pseudouridine synthase D Vibrio campbellii (strain ATCC BAA-1116)
C3LS20 3.81e-85 264 45 4 335 3 truD tRNA pseudouridine synthase D Vibrio cholerae serotype O1 (strain M66-2)
Q9KUJ0 3.81e-85 264 45 4 335 3 truD tRNA pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9D8 3.81e-85 264 45 4 335 3 truD tRNA pseudouridine synthase D Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q31J61 8.72e-82 255 42 5 333 3 truD tRNA pseudouridine synthase D Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3IDQ4 3.98e-76 241 38 4 334 3 truD tRNA pseudouridine synthase D Pseudoalteromonas translucida (strain TAC 125)
Q5QUC5 1.18e-75 239 42 4 326 3 truD tRNA pseudouridine synthase D Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q604M0 5.4e-75 238 40 2 331 3 truD tRNA pseudouridine synthase D Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3BUS6 8.64e-75 238 41 6 343 3 truD tRNA pseudouridine synthase D Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5WWQ2 1.37e-74 236 38 1 336 3 truD tRNA pseudouridine synthase D Legionella pneumophila (strain Lens)
Q8PLR6 4.17e-74 236 40 6 347 3 truD tRNA pseudouridine synthase D Xanthomonas axonopodis pv. citri (strain 306)
Q5GYK8 2.22e-73 234 41 5 346 3 truD tRNA pseudouridine synthase D Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1L2 2.22e-73 234 41 5 346 3 truD tRNA pseudouridine synthase D Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q4KHE9 1.85e-71 229 40 4 332 3 truD tRNA pseudouridine synthase D Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5ZV19 2.02e-71 228 37 1 329 3 truD tRNA pseudouridine synthase D Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5ICB9 3.14e-71 228 37 1 329 3 truD tRNA pseudouridine synthase D Legionella pneumophila (strain Corby)
Q5X4T2 3.29e-70 225 37 1 329 3 truD tRNA pseudouridine synthase D Legionella pneumophila (strain Paris)
Q8P9Y9 9.9e-70 225 39 6 347 3 truD tRNA pseudouridine synthase D Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UTP6 9.9e-70 225 39 6 347 3 truD tRNA pseudouridine synthase D Xanthomonas campestris pv. campestris (strain 8004)
B0RU01 3.8e-69 223 39 6 344 3 truD tRNA pseudouridine synthase D Xanthomonas campestris pv. campestris (strain B100)
Q3KH85 4.16e-68 220 40 5 339 3 truD tRNA pseudouridine synthase D Pseudomonas fluorescens (strain Pf0-1)
Q3JCS7 1.85e-66 216 41 8 333 3 truD tRNA pseudouridine synthase D Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q9HY04 2.25e-66 216 39 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V8C2 3.17e-66 216 39 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas aeruginosa (strain LESB58)
Q02R98 3.72e-66 215 39 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas aeruginosa (strain UCBPP-PA14)
C3K704 4.24e-66 215 39 5 339 3 truD tRNA pseudouridine synthase D Pseudomonas fluorescens (strain SBW25)
A6V1G2 4.28e-66 215 39 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas aeruginosa (strain PA7)
Q1I653 4.7e-65 212 41 4 334 3 truD tRNA pseudouridine synthase D Pseudomonas entomophila (strain L48)
A4XWR3 2.11e-62 206 40 4 337 3 truD tRNA pseudouridine synthase D Pseudomonas mendocina (strain ymp)
B3PJA9 9.76e-62 203 36 4 347 3 truD tRNA pseudouridine synthase D Cellvibrio japonicus (strain Ueda107)
Q4ZWQ1 2.76e-61 202 39 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas syringae pv. syringae (strain B728a)
Q88MF2 6.51e-61 202 40 2 321 3 truD tRNA pseudouridine synthase D Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q48F86 6.73e-61 202 39 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4VJV1 1.35e-60 201 38 6 339 3 truD tRNA pseudouridine synthase D Stutzerimonas stutzeri (strain A1501)
A5W822 6.65e-60 199 40 2 321 3 truD tRNA pseudouridine synthase D Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KSC6 1.67e-59 198 40 2 321 3 truD tRNA pseudouridine synthase D Pseudomonas putida (strain GB-1)
Q886L6 3.69e-59 197 38 2 331 3 truD tRNA pseudouridine synthase D Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1QU75 1.83e-57 192 38 7 339 3 truD tRNA pseudouridine synthase D Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B1JB31 3.03e-56 189 41 2 330 3 truD tRNA pseudouridine synthase D Pseudomonas putida (strain W619)
Q4FR14 2.01e-55 189 34 8 369 3 truD tRNA pseudouridine synthase D Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
C1DSR9 7.26e-53 181 38 4 337 3 truD tRNA pseudouridine synthase D Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1TZ52 1.09e-45 162 33 7 365 3 truD tRNA pseudouridine synthase D Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9RSX8 1.82e-43 156 34 6 332 3 truD tRNA pseudouridine synthase D Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q5SI49 3.88e-40 147 33 8 335 3 truD tRNA pseudouridine synthase D Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IG5 1.82e-39 145 33 8 335 3 truD tRNA pseudouridine synthase D Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q30RS1 1.17e-38 144 29 7 350 3 truD tRNA pseudouridine synthase D Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B8J7C8 1.55e-38 143 33 7 334 3 truD tRNA pseudouridine synthase D Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IFQ4 3.87e-38 142 32 8 342 3 truD tRNA pseudouridine synthase D Anaeromyxobacter dehalogenans (strain 2CP-C)
A7HGV2 1.25e-37 140 33 7 339 3 truD tRNA pseudouridine synthase D Anaeromyxobacter sp. (strain Fw109-5)
P59893 1.43e-36 138 28 7 347 3 truD tRNA pseudouridine synthase D Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9ZKS5 7.89e-31 123 27 11 367 3 truD tRNA pseudouridine synthase D Helicobacter pylori (strain J99 / ATCC 700824)
B6JME7 5.73e-30 121 27 11 356 3 truD tRNA pseudouridine synthase D Helicobacter pylori (strain P12)
Q1CSU8 6.53e-30 120 27 11 367 3 truD tRNA pseudouridine synthase D Helicobacter pylori (strain HPAG1)
B2UU74 7.23e-30 120 26 10 367 3 truD tRNA pseudouridine synthase D Helicobacter pylori (strain Shi470)
B5Z7T0 2.37e-29 119 25 10 367 3 truD tRNA pseudouridine synthase D Helicobacter pylori (strain G27)
P55985 2.76e-29 119 26 10 367 3 truD tRNA pseudouridine synthase D Helicobacter pylori (strain ATCC 700392 / 26695)
P59892 5.89e-29 118 31 2 196 3 truD tRNA pseudouridine synthase D Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q17WX3 7.82e-29 117 26 11 367 3 truD tRNA pseudouridine synthase D Helicobacter acinonychis (strain Sheeba)
Q3A6I8 1.44e-28 117 27 9 393 3 truD tRNA pseudouridine synthase D Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A6Q2U7 3.62e-26 110 24 8 354 3 truD tRNA pseudouridine synthase D Nitratiruptor sp. (strain SB155-2)
A8FNC4 1.28e-25 108 27 10 355 3 truD tRNA pseudouridine synthase D Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A1W165 1.5e-25 108 27 10 355 3 truD tRNA pseudouridine synthase D Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PMK3 3.38e-25 107 27 10 355 3 truD tRNA pseudouridine synthase D Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H5G6 1.57e-24 105 27 11 355 3 truD tRNA pseudouridine synthase D Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
C6E4K4 1.57e-24 106 38 2 160 3 truD tRNA pseudouridine synthase D Geobacter sp. (strain M21)
Q5HSX3 5.76e-24 104 27 10 355 3 truD tRNA pseudouridine synthase D Campylobacter jejuni (strain RM1221)
Q39R76 2.09e-23 103 36 3 167 3 truD tRNA pseudouridine synthase D Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q39R76 0.000442 45 30 5 153 3 truD tRNA pseudouridine synthase D Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9M644 4.55e-23 102 36 3 160 3 truD tRNA pseudouridine synthase D Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
P60347 1.55e-22 100 35 2 165 3 truD tRNA pseudouridine synthase D Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9HLL3 6.81e-21 96 34 3 155 3 truD Probable tRNA pseudouridine synthase D Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q978K9 4.37e-19 90 30 1 154 3 truD Probable tRNA pseudouridine synthase D Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
O28596 1.05e-18 89 32 1 158 3 truD Probable tRNA pseudouridine synthase D Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O27572 1.88e-18 89 31 1 163 3 truD Probable tRNA pseudouridine synthase D Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q6L1R2 8.13e-18 87 30 4 161 3 truD Probable tRNA pseudouridine synthase D Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
B6YTE4 3.36e-17 85 34 6 163 3 truD Probable tRNA pseudouridine synthase D Thermococcus onnurineus (strain NA1)
C5A1W0 6.24e-16 81 33 4 161 3 truD Probable tRNA pseudouridine synthase D Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
C6A1K9 1.59e-15 80 30 4 185 3 truD Probable tRNA pseudouridine synthase D Thermococcus sibiricus (strain DSM 12597 / MM 739)
Q12WH6 3.32e-15 79 33 4 159 3 truD Probable tRNA pseudouridine synthase D Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
A4FYL2 1.06e-14 77 32 5 165 3 truD Probable tRNA pseudouridine synthase D Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q6LZL0 1.11e-14 77 32 5 165 3 truD2 Probable tRNA pseudouridine synthase D 2 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q58759 3.04e-14 76 32 5 150 3 truD2 Probable tRNA pseudouridine synthase D 2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8TKX2 3.39e-14 76 31 4 160 3 truD Probable tRNA pseudouridine synthase D Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8F8N2 6.3e-14 75 32 3 151 3 truD tRNA pseudouridine synthase D Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72N01 6.3e-14 75 32 3 151 3 truD tRNA pseudouridine synthase D Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6M1A3 6.47e-14 75 28 4 150 3 truD1 Probable tRNA pseudouridine synthase D 1 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8U0N1 1.06e-13 75 22 15 409 3 truD Probable tRNA pseudouridine synthase D Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3IMF3 2.52e-13 73 32 3 162 3 truD Probable tRNA pseudouridine synthase D Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q5JDB6 3.09e-13 73 32 7 161 3 truD Probable tRNA pseudouridine synthase D Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q466V2 4.09e-13 73 28 2 155 3 truD Probable tRNA pseudouridine synthase D Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8Q0M2 6.11e-13 72 29 3 155 1 truD Probable tRNA pseudouridine synthase D Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8ZTR2 8.86e-13 72 30 3 159 3 truD Probable tRNA pseudouridine synthase D Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
A1RRV7 2.09e-12 71 30 3 164 3 truD Probable tRNA pseudouridine synthase D Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Q91VU7 3.08e-12 71 32 3 132 2 Pus7 Pseudouridylate synthase 7 homolog Mus musculus
A6USB0 3.38e-12 70 29 4 167 3 truD Probable tRNA pseudouridine synthase D Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A4WLG8 3.44e-12 70 30 3 162 3 truD Probable tRNA pseudouridine synthase D Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
O59207 5.07e-12 70 29 2 165 3 truD Probable tRNA pseudouridine synthase D Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9VSK9 5.13e-12 70 33 1 128 1 Pus7 Pseudouridylate synthase 7 homolog Drosophila melanogaster
O67616 5.19e-12 69 28 3 150 3 truD tRNA pseudouridine synthase D Aquifex aeolicus (strain VF5)
Q08DI8 7.66e-12 70 32 3 132 2 PUS7 Pseudouridylate synthase 7 homolog Bos taurus
A6UV17 8.66e-12 69 29 5 172 3 truD Probable tRNA pseudouridine synthase D Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q9HSG5 1.01e-11 69 33 5 164 3 truD Probable tRNA pseudouridine synthase D Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R2Y4 1.01e-11 69 33 5 164 3 truD Probable tRNA pseudouridine synthase D Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9H0K6 1.81e-11 68 37 4 108 1 PUS7L Pseudouridylate synthase PUS7L Homo sapiens
Q96PZ0 2.64e-11 68 31 3 132 1 PUS7 Pseudouridylate synthase 7 homolog Homo sapiens
B1Y9W7 3.09e-11 67 31 3 160 3 truD Probable tRNA pseudouridine synthase D Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
Q9V107 4.29e-11 67 30 6 171 3 truD Probable tRNA pseudouridine synthase D Pyrococcus abyssi (strain GE5 / Orsay)
Q5V1E6 1.27e-10 65 30 5 180 3 truD Probable tRNA pseudouridine synthase D Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q8TXJ7 1.29e-10 65 32 3 129 3 truD Probable tRNA pseudouridine synthase D Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8CE46 1.62e-10 65 36 3 105 1 Pus7l Pseudouridylate synthase PUS7L Mus musculus
Q58008 3.64e-10 64 26 5 181 3 truD1 Probable tRNA pseudouridine synthase D 1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q08647 1.91e-09 62 29 2 143 1 PUS7 Multisubstrate pseudouridine synthase 7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q1L8I0 3.25e-09 62 28 2 133 2 pus7l Pseudouridylate synthase PUS7L Danio rerio
O74343 4.59e-09 61 31 2 132 3 pus7 Multisubstrate pseudouridine synthase 7 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q17426 5.91e-09 60 29 4 156 3 B0024.11 Putative pseudouridine synthase B0024.11 Caenorhabditis elegans
P60348 0.000756 44 22 4 165 3 truD Probable tRNA pseudouridine synthase D Nanoarchaeum equitans (strain Kin4-M)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13900
Feature type CDS
Gene truD
Product tRNA pseudouridine(13) synthase TruD
Location 416977 - 418023 (strand: -1)
Length 1047 (nucleotides) / 348 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2352
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01142 tRNA pseudouridine synthase D (TruD)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0585 Translation, ribosomal structure and biogenesis (J) J tRNA(Glu) U13 pseudouridine synthase TruD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06176 tRNA pseudouridine13 synthase [EC:5.4.99.27] - -

Protein Sequence

MSLNVSWFHGKPVATGVLKAQPEDFFVQEDLGFEPDGEGEHVMVRVRKTGCNTRFVAEQLAKFSKIAARSVSYAGLKDRHAVTEQWFCLQMPGKETPDFSKLEVEGCEVLDVTRQKRKLRIGTLKGNHFTLVLRQISDRAAVEQRLQSITEQGVPNYFGEQRFGRGGQNLYFARRWANAEINVTDRSKRSFYLSAARSAMFNAVADARITQHLQATVLSGDAVQLAGRGSWFVAQPEEQADVQQRLDNRELRITAPLPGKGDLGTQDAALVFETEQLADWQALWQLAAKEGVENARRAVMLYPENFVSEWMDDETVRLSFFLPAGCFATSVIREVIELAADQAAEFSE

Flanking regions ( +/- flanking 50bp)

AAAGAAGGGATCGCCTGCGAAGCCGTCGTATTACTTGTTAAGGTCGCACAATGAGCCTGAATGTCAGCTGGTTTCACGGAAAACCGGTTGCGACCGGCGTATTAAAAGCACAGCCGGAAGATTTTTTTGTTCAGGAAGATCTGGGTTTTGAGCCGGATGGCGAGGGCGAACATGTCATGGTGCGCGTCCGGAAAACCGGCTGTAACACCCGGTTTGTCGCGGAACAACTGGCTAAATTTTCTAAAATCGCAGCCCGGTCAGTCAGTTATGCGGGGCTGAAAGATCGCCACGCAGTGACTGAACAATGGTTCTGCCTGCAAATGCCCGGCAAAGAGACGCCGGATTTCAGTAAGCTGGAAGTGGAAGGCTGCGAAGTGCTGGATGTCACCCGGCAAAAACGCAAGTTGCGCATCGGCACACTGAAAGGTAATCACTTTACCCTTGTGTTGCGCCAGATTAGTGACCGCGCAGCGGTGGAGCAGCGCTTGCAATCTATTACTGAGCAGGGTGTACCGAATTATTTCGGCGAACAGCGCTTCGGGCGCGGTGGTCAGAATCTGTATTTTGCCCGCCGCTGGGCAAATGCAGAGATCAATGTAACCGATCGCAGCAAGCGCAGCTTTTATCTTTCCGCGGCGCGCAGTGCGATGTTTAACGCGGTGGCAGATGCCCGCATTACTCAGCATTTACAGGCAACAGTGCTGTCCGGTGATGCAGTACAGCTTGCCGGGCGCGGGAGTTGGTTTGTGGCACAGCCGGAAGAACAGGCTGATGTACAGCAGCGCCTTGATAACCGGGAGTTGCGCATTACGGCACCGTTACCGGGTAAAGGTGATTTGGGTACTCAGGATGCTGCGCTGGTATTTGAAACGGAACAATTAGCTGACTGGCAGGCATTATGGCAGTTGGCAGCAAAAGAAGGGGTGGAGAATGCCCGCCGTGCCGTCATGCTGTATCCGGAAAATTTTGTCAGTGAATGGATGGATGATGAAACAGTCCGGCTCTCGTTCTTCCTGCCGGCAGGCTGCTTTGCGACCAGTGTTATCCGCGAAGTGATTGAGCTGGCAGCCGATCAGGCGGCAGAGTTCAGCGAATAGTTAAGCAAATAGTTAAGCAGATATCTCAGAGAATAAAAACGGGCAGGTGA