Homologs in group_1307

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08005 FBDBKF_08005 87.5 Morganella morganii S1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
EHELCC_13835 EHELCC_13835 87.5 Morganella morganii S2 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
NLDBIP_14280 NLDBIP_14280 87.5 Morganella morganii S4 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
LHKJJB_08570 LHKJJB_08570 87.5 Morganella morganii S3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
HKOGLL_08120 HKOGLL_08120 87.5 Morganella morganii S5 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
PMI_RS00950 PMI_RS00950 65.4 Proteus mirabilis HI4320 folK 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

Distribution of the homologs in the orthogroup group_1307

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1307

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P26281 6.64e-67 203 62 0 159 1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Escherichia coli (strain K12)
P43777 9.29e-49 157 44 1 156 1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HV71 1.53e-44 147 52 1 153 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C0G2 2.05e-39 134 43 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes
P0C0G3 2.05e-39 134 43 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M1
Q5XCA6 1.83e-38 131 42 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8P151 2.89e-38 131 42 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DB11 5.81e-38 130 42 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB10 5.81e-38 130 42 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P71512 2.63e-34 120 41 2 156 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
P72736 1.25e-30 112 40 4 155 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P29252 1.49e-29 108 40 3 156 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Bacillus subtilis (strain 168)
Q4LB35 7.69e-29 114 38 2 157 1 fol1 Folic acid synthesis protein fol1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O87790 7.75e-27 100 54 2 118 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (Fragment) Pseudomonas putida
O66550 1.56e-24 95 35 2 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Aquifex aeolicus (strain VF5)
Q8GJP4 9.39e-23 95 38 1 132 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. cremoris (strain MG1363)
Q1ENB6 1.33e-22 96 39 1 129 1 CytHPPK/DHPS Folate synthesis bifunctional protein Arabidopsis thaliana
P29251 4.98e-21 92 37 2 136 1 fol1 Folic acid synthesis protein fol1 Pneumocystis carinii
Q9SZV3 5.04e-21 91 40 2 129 2 MitHPPK/DHPS Folate synthesis bifunctional protein, mitochondrial Arabidopsis thaliana
O04862 1.66e-20 90 40 2 129 1 MitHPPK/DHPS Folate synthesis bifunctional protein, mitochondrial Pisum sativum
Q54YD9 1.23e-17 82 34 3 137 3 fol1 Folic acid synthesis protein FOL1 Dictyostelium discoideum
P59657 4.91e-17 79 35 2 135 1 sulD Bifunctional folate synthesis protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P22291 4.96e-17 79 35 2 135 1 sulD Bifunctional folate synthesis protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O84619 2.92e-14 72 31 4 138 3 folKP Folate synthesis bifunctional protein Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O25680 5.46e-14 68 31 1 128 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM35 5.58e-14 68 31 1 128 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Helicobacter pylori (strain J99 / ATCC 700824)
P53848 5.75e-14 71 31 1 133 1 FOL1 Folic acid synthesis protein FOL1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P82602 5.92e-14 71 30 6 164 3 folKP Folate synthesis bifunctional protein Chlamydia muridarum (strain MoPn / Nigg)
Q9CGE3 1.05e-13 70 36 1 132 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. lactis (strain IL1403)
Q821E2 2.26e-13 69 30 2 140 3 folKP Folate synthesis bifunctional protein Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P0C936 3.76e-13 66 33 3 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RI92 3.76e-13 66 33 3 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
P9WNC7 4.19e-11 61 33 5 145 1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNC6 4.19e-11 61 33 5 145 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64144 4.19e-11 61 33 5 145 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9PJ54 1.67e-10 59 29 1 127 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9Z7E8 1.76e-09 58 31 5 140 3 folKP Folate synthesis bifunctional protein Chlamydia pneumoniae
O69528 3.64e-09 56 31 4 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium leprae (strain TN)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12980
Feature type CDS
Gene folK
Product 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
Location 209097 - 209579 (strand: 1)
Length 483 (nucleotides) / 160 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1307
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01288 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0801 Coenzyme transport and metabolism (H) H 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Folate biosynthesis
Metabolic pathways
Biosynthesis of cofactors		 Tetrahydrofolate biosynthesis, GTP => THF

Protein Sequence

MIPVYIAIGSNLDSPLDQVNRAIAALNDIPQSRLVRHSAFYRTAPMGPAGQPDYLNLAVLLDTTLTPHELLDATQAIELSQGRVRKDERWGPRSLDLDIMLFGDKVIHDERLTVPHYGLKEREFMLYPLAEIAPGLILPDGESLADVIARTPENGLALWS

Flanking regions ( +/- flanking 50bp)

CCGCGCCGTCGTCACCCGCGTTCCCGTCAGGGTAATGAGAACAATGCATCGTGATCCCGGTCTATATTGCCATCGGCAGTAACCTGGACTCTCCGTTGGATCAGGTCAACCGGGCGATTGCGGCATTAAATGATATACCGCAAAGCCGCCTGGTGCGCCACTCTGCATTCTACCGCACCGCACCAATGGGGCCTGCCGGTCAGCCTGATTATCTCAATCTGGCTGTCCTGCTTGACACCACGCTGACCCCGCATGAGCTGCTTGATGCCACCCAGGCTATCGAGCTGTCACAAGGTCGTGTGCGCAAAGATGAGCGCTGGGGTCCGCGCTCGTTAGACTTAGATATTATGCTGTTTGGTGATAAAGTCATTCATGATGAACGGCTGACCGTACCGCATTATGGCTTGAAAGAGCGTGAATTTATGCTGTACCCACTGGCAGAGATAGCGCCCGGGCTTATCCTGCCGGATGGCGAATCACTGGCAGACGTTATCGCCCGTACCCCGGAAAACGGGCTCGCGCTCTGGTCGTGAGACACGCCGGGACTCTGTACTTTTGGCTTACCGGACACAGACAAGGAGAC