Homologs in group_1364

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08005 FBDBKF_08005 100.0 Morganella morganii S1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
NLDBIP_14280 NLDBIP_14280 100.0 Morganella morganii S4 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
LHKJJB_08570 LHKJJB_08570 100.0 Morganella morganii S3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
HKOGLL_08120 HKOGLL_08120 100.0 Morganella morganii S5 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
F4V73_RS12980 F4V73_RS12980 87.5 Morganella psychrotolerans folK 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
PMI_RS00950 PMI_RS00950 63.5 Proteus mirabilis HI4320 folK 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

Distribution of the homologs in the orthogroup group_1364

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1364

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P26281 2.49e-65 199 62 0 159 1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Escherichia coli (strain K12)
P43777 5.29e-48 155 46 1 156 1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HV71 5.65e-44 145 52 1 153 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C0G2 1.21e-35 124 40 2 164 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes
P0C0G3 1.21e-35 124 40 2 164 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M1
P71512 6.71e-35 122 42 2 156 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
Q5XCA6 8.43e-35 122 40 2 164 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8P151 1.5e-34 122 40 2 164 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DB11 2.43e-34 121 43 1 144 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB10 2.43e-34 121 43 1 144 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P72736 1.05e-31 115 45 2 134 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4LB35 1.14e-29 117 38 2 158 1 fol1 Folic acid synthesis protein fol1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P29252 3.88e-28 105 39 2 161 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Bacillus subtilis (strain 168)
O87790 5.78e-25 95 53 2 118 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (Fragment) Pseudomonas putida
O66550 1.55e-23 93 35 4 157 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Aquifex aeolicus (strain VF5)
Q8GJP4 5.15e-23 96 35 2 154 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. cremoris (strain MG1363)
Q9SZV3 9.64e-22 94 41 3 131 2 MitHPPK/DHPS Folate synthesis bifunctional protein, mitochondrial Arabidopsis thaliana
Q1ENB6 1.45e-20 90 37 1 129 1 CytHPPK/DHPS Folate synthesis bifunctional protein Arabidopsis thaliana
P29251 1.58e-19 87 36 2 136 1 fol1 Folic acid synthesis protein fol1 Pneumocystis carinii
O04862 4.37e-19 86 39 2 129 1 MitHPPK/DHPS Folate synthesis bifunctional protein, mitochondrial Pisum sativum
Q54YD9 3.91e-18 84 36 2 136 3 fol1 Folic acid synthesis protein FOL1 Dictyostelium discoideum
P59657 8.73e-17 78 37 2 135 1 sulD Bifunctional folate synthesis protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P22291 9.38e-17 78 37 2 135 1 sulD Bifunctional folate synthesis protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P53848 1.64e-15 76 32 3 147 1 FOL1 Folic acid synthesis protein FOL1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0C936 7.22e-15 70 35 3 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RI92 7.22e-15 70 35 3 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
O25680 1.88e-14 70 32 1 128 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM35 1.99e-14 70 32 1 128 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Helicobacter pylori (strain J99 / ATCC 700824)
Q9CGE3 4.88e-14 71 35 1 132 3 folKE Bifunctional protein FolKE Lactococcus lactis subsp. lactis (strain IL1403)
O84619 4.97e-13 68 28 6 178 3 folKP Folate synthesis bifunctional protein Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P82602 3.72e-12 66 30 5 140 3 folKP Folate synthesis bifunctional protein Chlamydia muridarum (strain MoPn / Nigg)
P9WNC7 4.39e-12 64 34 5 145 1 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNC6 4.39e-12 64 34 5 145 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64144 4.39e-12 64 34 5 145 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q821E2 1.53e-11 64 29 2 140 3 folKP Folate synthesis bifunctional protein Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
O69528 3.16e-11 62 33 4 139 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Mycobacterium leprae (strain TN)
Q9Z7E8 1.5e-10 62 30 4 139 3 folKP Folate synthesis bifunctional protein Chlamydia pneumoniae
Q9PJ54 7.01e-09 55 29 1 127 3 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13835
Feature type CDS
Gene folK
Product 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
Location 107671 - 108171 (strand: -1)
Length 501 (nucleotides) / 166 (amino acids)
In genomic island -

Contig

Accession ZDB_223
Length 138954 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1364
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01288 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0801 Coenzyme transport and metabolism (H) H 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00950 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3] Folate biosynthesis
Metabolic pathways
Biosynthesis of cofactors
Tetrahydrofolate biosynthesis, GTP => THF

Protein Sequence

MIPVYIAIGSNLADPLDQVNRAIAALGAVPQSRLVRHSAFYRTAPMGPAGQPDYLNAAVLLETDLTPHQLLDATQAIELAHGRVRKDERWGPRTLDLDIMLFGDMVISDARLTVPHYGLKVREFMLYPLAEIAPGLILPDGEPLAAVVARTPENGLGLWSSSEPVR

Flanking regions ( +/- flanking 50bp)

CCGCGCCGCCGCCATCCGCGTGCCCGTCAGGGTAACGGAAACAGTGAATCATGATTCCGGTCTATATTGCGATCGGCAGTAATCTTGCCGACCCGCTGGATCAGGTCAACCGGGCGATTGCCGCGCTGGGAGCTGTCCCGCAAAGCCGCCTGGTGCGCCACTCCGCTTTTTACCGCACCGCGCCGATGGGACCTGCCGGACAGCCTGATTATCTTAATGCGGCTGTTCTGCTGGAAACTGACCTGACACCGCACCAGCTGCTCGATGCCACCCAGGCTATCGAACTGGCGCACGGACGTGTCCGCAAGGATGAGCGCTGGGGTCCCCGCACGTTAGACTTAGATATCATGCTGTTTGGTGATATGGTCATCAGTGATGCGCGGCTGACCGTGCCGCATTACGGCCTGAAAGTGCGTGAATTTATGCTGTACCCGCTGGCTGAAATCGCCCCCGGGCTGATTCTGCCGGACGGCGAACCACTTGCGGCGGTTGTTGCCCGCACCCCGGAAAACGGGCTTGGCCTCTGGTCATCATCAGAGCCGGTACGCTGAACTTTCTGCTCAACAGACAGACAAGGAGACACTGATGCGGATTATTGAAA