Homologs in group_48

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02200 FBDBKF_02200 25.5 Morganella morganii S1 lsrK autoinducer-2 kinase
FBDBKF_04695 FBDBKF_04695 87.5 Morganella morganii S1 xylB xylulokinase
EHELCC_02670 EHELCC_02670 25.5 Morganella morganii S2 lsrK autoinducer-2 kinase
EHELCC_05985 EHELCC_05985 87.5 Morganella morganii S2 xylB xylulokinase
NLDBIP_00790 NLDBIP_00790 25.5 Morganella morganii S4 lsrK autoinducer-2 kinase
NLDBIP_06305 NLDBIP_06305 87.5 Morganella morganii S4 xylB xylulokinase
LHKJJB_01245 LHKJJB_01245 25.5 Morganella morganii S3 lsrK autoinducer-2 kinase
LHKJJB_03185 LHKJJB_03185 87.5 Morganella morganii S3 xylB xylulokinase
HKOGLL_01285 HKOGLL_01285 25.5 Morganella morganii S5 lsrK autoinducer-2 kinase
HKOGLL_06660 HKOGLL_06660 87.5 Morganella morganii S5 xylB xylulokinase
F4V73_RS04570 F4V73_RS04570 25.8 Morganella psychrotolerans lsrK autoinducer-2 kinase
PMI_RS06145 PMI_RS06145 32.3 Proteus mirabilis HI4320 xylB xylulokinase

Distribution of the homologs in the orthogroup group_48

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_48

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P44401 0.0 528 48 2 500 3 xylB Xylulose kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RK00 5.9e-79 258 37 10 425 3 xylB Xylulose kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P27156 3.04e-73 243 37 9 415 3 xylB Xylulose kinase Streptomyces rubiginosus
P39211 1.87e-68 231 30 10 502 3 xylB Xylulose kinase Bacillus subtilis (strain 168)
Q8CR47 1.01e-64 221 31 13 496 3 xylB Xylulose kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL88 2.12e-64 220 30 13 496 3 xylB Xylulose kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P12867 2.23e-62 214 32 8 452 3 xylB Xylulose kinase Actinoplanes missouriensis (strain ATCC 14538 / DSM 43046 / CBS 188.64 / JCM 3121 / NBRC 102363 / NCIMB 12654 / NRRL B-3342 / UNCC 431)
Q9CFG8 1.71e-60 209 31 14 498 3 xylB Xylulose kinase Lactococcus lactis subsp. lactis (strain IL1403)
P35850 9.86e-60 207 30 12 497 2 xylB Xylulose kinase Levilactobacillus brevis
P21939 3.32e-50 182 28 12 504 3 xylB Xylulose kinase Lactiplantibacillus pentosus
P27155 1.76e-48 177 26 14 500 3 xylB Xylulose kinase Staphylococcus xylosus
P09099 1.95e-44 166 28 17 513 1 xylB Xylulose kinase Escherichia coli (strain K12)
P29444 2.24e-42 160 29 12 445 3 xylB Xylulose kinase Klebsiella pneumoniae
P12011 1.23e-36 145 26 12 461 3 gntK Gluconokinase Bacillus subtilis (strain 168)
P46834 6.4e-35 140 25 10 459 3 gntK Gluconokinase Bacillus licheniformis
P57928 5.4e-32 131 25 11 503 3 lyx Probable L-xylulose kinase Pasteurella multocida (strain Pm70)
P30646 3.81e-26 115 23 16 528 3 R08D7.7 Uncharacterized sugar kinase R08D7.7 Caenorhabditis elegans
Q3TNA1 1.17e-25 114 24 16 533 1 Xylb Xylulose kinase Mus musculus
O75191 6.16e-25 111 23 16 530 1 XYLB Xylulose kinase Homo sapiens
P44991 1.28e-23 107 22 11 514 3 lyx Probable L-xylulose kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3SYZ6 2.96e-23 106 23 14 480 2 XYLB Xylulose kinase Bos taurus
Q3MIF4 1.07e-22 104 23 16 540 2 Xylb Xylulose kinase Rattus norvegicus
Q5R830 4.43e-22 103 22 13 477 2 XYLB Xylulose kinase Pongo abelii
A7ZLW9 4.96e-22 102 24 14 517 3 lsrK Autoinducer-2 kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
P77432 5.85e-22 102 24 14 517 1 lsrK Autoinducer-2 kinase Escherichia coli (strain K12)
B1XE99 5.85e-22 102 24 14 517 3 lsrK Autoinducer-2 kinase Escherichia coli (strain K12 / DH10B)
B1LFA4 6.7e-22 102 24 14 517 3 lsrK Autoinducer-2 kinase Escherichia coli (strain SMS-3-5 / SECEC)
B1IRU9 1.89e-21 100 24 14 517 3 lsrK Autoinducer-2 kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q9KBQ3 2.68e-21 100 21 13 529 1 araB Ribulokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8A064 1.19e-20 98 24 10 457 3 lsrK Autoinducer-2 kinase Escherichia coli O9:H4 (strain HS)
A9MZF8 1.34e-20 98 24 15 512 3 lsrK Autoinducer-2 kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
O93623 1.59e-20 97 23 17 490 1 glpK Glycerol kinase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8Z2X3 1.93e-20 97 24 15 512 3 lsrK Autoinducer-2 kinase Salmonella typhi
A4WER6 2e-20 97 22 12 512 3 lsrK Autoinducer-2 kinase Enterobacter sp. (strain 638)
Q8ZKQ6 7.63e-20 96 24 15 512 1 lsrK Autoinducer-2 kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57HE4 1.7e-19 95 24 15 512 3 lsrK Autoinducer-2 kinase Salmonella choleraesuis (strain SC-B67)
Q5ASE0 1.73e-19 95 24 21 542 2 xkiA Probable D-xylulose kinase A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A6TEC0 1.79e-19 95 21 12 519 3 lsrK Autoinducer-2 kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5PJE9 1.83e-19 94 23 15 512 3 lsrK Autoinducer-2 kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A1JJ57 1.86e-19 94 23 9 458 3 lsrK Autoinducer-2 kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q5WL06 3.84e-19 94 24 20 547 3 araB Ribulokinase Shouchella clausii (strain KSM-K16)
Q7N2E1 8.08e-19 92 22 12 506 3 lsrK Autoinducer-2 kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9S468 2.2e-18 91 24 18 530 3 araB Ribulokinase Geobacillus stearothermophilus
Q5KYP6 2.24e-18 91 24 19 536 3 araB Ribulokinase Geobacillus kaustophilus (strain HTA426)
Q12GA2 2.72e-18 91 26 18 468 3 glpK Glycerol kinase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0CIL2 3.61e-18 91 23 16 513 2 xkiA Probable D-xylulose kinase A Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q8TZI8 5.83e-18 90 22 16 488 3 glpK Glycerol kinase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
C5A1M3 7.74e-18 89 24 13 449 3 glpK Glycerol kinase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
P37677 7.83e-18 89 23 16 514 1 lyx L-xylulose/3-keto-L-gulonate kinase Escherichia coli (strain K12)
Q949W8 9.89e-18 89 22 12 491 1 XK2 Xylulose kinase 2 Arabidopsis thaliana
Q9V207 1.16e-17 89 23 14 448 3 glpK Glycerol kinase Pyrococcus abyssi (strain GE5 / Orsay)
A4IPA2 1.34e-17 89 24 19 536 3 araB Ribulokinase Geobacillus thermodenitrificans (strain NG80-2)
B8NTI4 5.28e-17 87 22 14 515 2 xkiA Probable D-xylulose kinase A Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
B7GGV9 5.41e-17 87 24 20 544 3 araB Ribulokinase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q9X049 7.97e-17 86 25 19 460 3 glpK1 Glycerol kinase 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1VJ23 1.07e-16 86 24 17 474 3 glpK Glycerol kinase Polaromonas naphthalenivorans (strain CJ2)
B6YT00 1.71e-16 85 23 12 447 3 glpK Glycerol kinase Thermococcus onnurineus (strain NA1)
A4G1Q7 2.81e-16 85 25 20 463 3 glpK Glycerol kinase Herminiimonas arsenicoxydans
Q21S75 2.89e-16 84 25 17 477 3 glpK Glycerol kinase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2U3V4 3.15e-16 85 22 14 515 2 xkiA Probable D-xylulose kinase A Aspergillus oryzae (strain ATCC 42149 / RIB 40)
B1JLP8 3.55e-16 84 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q5FHZ6 3.97e-16 84 23 14 453 3 glpK Glycerol kinase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1IMB2 4.47e-16 84 25 16 473 3 glpK Glycerol kinase Koribacter versatilis (strain Ellin345)
P42826 5.77e-16 84 24 10 398 1 XKS1 Xylulose kinase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A1CAU3 5.98e-16 84 24 19 526 2 xkiA Probable D-xylulose kinase A Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q8XAY5 7.36e-16 84 24 15 520 3 lsrK Autoinducer-2 kinase Escherichia coli O157:H7
Q38XX6 8.1e-16 83 24 14 475 3 glpK Glycerol kinase Latilactobacillus sakei subsp. sakei (strain 23K)
Q5FP70 1.02e-15 83 26 18 453 3 glpK Glycerol kinase Gluconobacter oxydans (strain 621H)
Q5Z175 1.04e-15 83 25 18 447 3 glpK Glycerol kinase Nocardia farcinica (strain IFM 10152)
Q1CN11 1.05e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WJP7 1.05e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pestis
Q1C142 1.05e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pestis bv. Antiqua (strain Antiqua)
O34861 1.15e-15 82 24 13 402 2 yoaC Putative sugar kinase YoaC Bacillus subtilis (strain 168)
Q66EY7 1.16e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQL2 1.16e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pestis (strain Pestoides F)
B2K3G3 1.16e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FMJ5 1.16e-15 83 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7P1G2 1.46e-15 82 25 15 454 3 glpK Glycerol kinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
C5FSW4 2.43e-15 82 22 16 557 2 xkiA Probable D-xylulose kinase A Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P11553 2.51e-15 82 23 13 453 1 fucK L-fuculokinase Escherichia coli (strain K12)
P95907 2.77e-15 82 25 15 450 3 glpK2 Glycerol kinase 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q4UZR8 3.49e-15 81 23 12 450 3 glpK Glycerol kinase Xanthomonas campestris pv. campestris (strain 8004)
A9R072 4.17e-15 81 22 9 458 3 lsrK Autoinducer-2 kinase Yersinia pestis bv. Antiqua (strain Angola)
Q5WL39 5.04e-15 81 27 3 242 3 rhaAB Bifunctional enzyme RhaA/RhaB Shouchella clausii (strain KSM-K16)
Q8X6R3 6.54e-15 80 23 13 453 3 fucK L-fuculokinase Escherichia coli O157:H7
Q8PDI0 7.77e-15 80 22 12 450 3 glpK Glycerol kinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RMN0 7.77e-15 80 22 12 450 3 glpK Glycerol kinase Xanthomonas campestris pv. campestris (strain B100)
Q9X1E4 9.2e-15 80 22 13 456 3 glpK2 Glycerol kinase 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q88NX8 1.11e-14 80 24 17 491 3 glpK Glycerol kinase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P94524 1.12e-14 80 21 19 549 2 araB Ribulokinase Bacillus subtilis (strain 168)
Q4K734 1.18e-14 79 24 15 453 3 glpK Glycerol kinase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48F01 1.31e-14 79 24 16 479 3 glpK Glycerol kinase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B5EB79 1.47e-14 79 26 14 397 3 glpK Glycerol kinase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q87XL0 1.73e-14 79 24 16 479 3 glpK Glycerol kinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3E6Z6 1.79e-14 79 24 16 457 3 glpK Glycerol kinase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q4ZPI7 2.27e-14 79 24 16 479 3 glpK Glycerol kinase Pseudomonas syringae pv. syringae (strain B728a)
Q9HY41 2.39e-14 79 23 13 449 3 glpK1 Glycerol kinase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q827G1 2.5e-14 79 23 16 444 3 glpK2 Glycerol kinase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A9AFH2 2.78e-14 78 24 14 453 3 glpK Glycerol kinase Burkholderia multivorans (strain ATCC 17616 / 249)
B0KUG0 3.03e-14 78 24 16 491 3 glpK Glycerol kinase Pseudomonas putida (strain GB-1)
B1YWB2 3.15e-14 78 23 13 453 3 glpK Glycerol kinase Burkholderia ambifaria (strain MC40-6)
B8DL62 3.23e-14 78 24 16 463 3 glpK Glycerol kinase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A5VZG7 3.28e-14 78 24 17 491 3 glpK Glycerol kinase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1WVJ0 3.3e-14 78 23 15 465 3 glpK Glycerol kinase Ligilactobacillus salivarius (strain UCC118)
A1WT61 3.51e-14 78 24 16 469 3 glpK Glycerol kinase Halorhodospira halophila (strain DSM 244 / SL1)
Q8FLY8 4.51e-14 78 23 16 468 3 glpK Glycerol kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q4WUV8 4.9e-14 78 22 15 515 2 xkiA Probable D-xylulose kinase A Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0Y4D5 4.9e-14 78 22 15 515 2 xkiA Probable D-xylulose kinase A Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
O34154 4.97e-14 77 22 14 460 1 glpK Glycerol kinase Enterococcus faecalis (strain ATCC 700802 / V583)
P26909 5.91e-14 70 41 3 106 3 xylB Xylulose kinase (Fragment) Arthrobacter sp. (strain NRRL B3728)
Q0BC36 6.76e-14 77 23 13 453 3 glpK Glycerol kinase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0VRN6 7.13e-14 77 25 15 450 3 glpK Glycerol kinase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3BYR0 7.3e-14 77 22 11 449 3 glpK Glycerol kinase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q83D14 7.34e-14 77 24 14 453 3 glpK Glycerol kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KCL1 7.34e-14 77 24 14 453 3 glpK Glycerol kinase Coxiella burnetii (strain Dugway 5J108-111)
A2QMS4 7.38e-14 77 23 19 517 2 xkiA Probable D-xylulose kinase A Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A9NCY5 7.4e-14 77 24 14 453 3 glpK Glycerol kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q39V17 7.43e-14 77 25 16 468 3 glpK Glycerol kinase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8X167 8.43e-14 77 23 19 517 1 xkiA D-xylulose kinase A Aspergillus niger
Q1QVQ3 8.53e-14 77 26 20 454 3 glpK Glycerol kinase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6SUL1 8.54e-14 77 24 17 458 3 glpK Glycerol kinase Janthinobacterium sp. (strain Marseille)
C3MUZ1 8.76e-14 77 23 18 452 3 glpK Glycerol kinase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C4KEH1 8.76e-14 77 23 18 452 3 glpK Glycerol kinase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Q1IE16 9.11e-14 77 24 13 451 3 glpK Glycerol kinase Pseudomonas entomophila (strain L48)
Q8PQG7 9.19e-14 77 22 11 449 3 glpK Glycerol kinase Xanthomonas axonopodis pv. citri (strain 306)
Q1BTT7 1.02e-13 77 23 14 453 3 glpK Glycerol kinase Burkholderia orbicola (strain AU 1054)
B1JY43 1.02e-13 77 23 14 453 3 glpK Glycerol kinase Burkholderia orbicola (strain MC0-3)
A0KAA1 1.02e-13 77 23 14 453 3 glpK Glycerol kinase Burkholderia cenocepacia (strain HI2424)
Q8ZMC5 1.08e-13 76 23 12 452 3 fucK L-fuculokinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B1Y1L9 1.22e-13 76 23 12 459 3 glpK Glycerol kinase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A8F679 1.33e-13 76 24 25 501 3 glpK Glycerol kinase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
A4WRT7 1.4e-13 76 25 17 455 3 glpK Glycerol kinase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q97XW1 2.22e-13 75 23 18 452 3 glpK1 Glycerol kinase 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A1REY5 2.24e-13 75 24 19 491 3 glpK Glycerol kinase Shewanella sp. (strain W3-18-1)
A4Y2M5 2.24e-13 75 24 19 491 3 glpK Glycerol kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4JHM8 2.53e-13 75 23 14 453 3 glpK Glycerol kinase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A1U326 2.62e-13 75 23 13 450 3 glpK Glycerol kinase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0SNS0 2.73e-13 75 23 16 461 3 glpK Glycerol kinase Borreliella afzelii (strain PKo)
A9WJ21 2.85e-13 75 25 17 441 3 glpK Glycerol kinase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
C1DHV0 3.2e-13 75 24 13 450 3 glpK Glycerol kinase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q6MTY7 3.62e-13 75 23 15 452 3 glpK Glycerol kinase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
C3NAM2 3.85e-13 75 23 18 452 3 glpK Glycerol kinase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MP45 3.85e-13 75 23 18 452 3 glpK Glycerol kinase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
B5RL65 4.08e-13 75 23 18 472 3 glpK Glycerol kinase Borrelia duttonii (strain Ly)
B7J1G9 4.24e-13 75 23 16 461 3 glpK Glycerol kinase Borreliella burgdorferi (strain ZS7)
O51257 4.24e-13 75 23 16 461 3 glpK Glycerol kinase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8ESX1 4.47e-13 74 28 2 185 3 rhaB Rhamnulokinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B8GC51 4.56e-13 75 25 17 441 3 glpK Glycerol kinase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q3K7I5 5.1e-13 74 23 15 453 3 glpK Glycerol kinase Pseudomonas fluorescens (strain Pf0-1)
A4XXN1 5.9e-13 74 24 15 449 3 glpK Glycerol kinase Pseudomonas mendocina (strain ymp)
B9LD34 6.16e-13 74 25 17 441 3 glpK Glycerol kinase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
Q749I1 6.64e-13 74 24 16 457 3 glpK Glycerol kinase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q0AEC9 7.5e-13 74 24 14 451 3 glpK Glycerol kinase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8ENK7 8.22e-13 74 22 15 459 3 glpK Glycerol kinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q51390 9.01e-13 73 23 16 479 3 glpK2 Glycerol kinase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8Z428 1.02e-12 73 23 12 452 3 fucK L-fuculokinase Salmonella typhi
Q662C3 1.11e-12 73 23 16 461 3 glpK Glycerol kinase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B9MBT7 1.12e-12 73 25 20 508 3 glpK Glycerol kinase Acidovorax ebreus (strain TPSY)
Q63X50 1.6e-12 73 24 16 457 3 glpK Glycerol kinase Burkholderia pseudomallei (strain K96243)
Q2T0Z3 1.73e-12 73 24 16 457 3 glpK Glycerol kinase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8E1T0 1.88e-12 73 22 14 453 3 glpK Glycerol kinase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E794 1.88e-12 73 22 14 453 3 glpK Glycerol kinase Streptococcus agalactiae serotype III (strain NEM316)
Q3K3A6 1.88e-12 73 22 14 453 3 glpK Glycerol kinase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B8IKN3 1.88e-12 73 24 17 458 3 glpK Glycerol kinase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q89UK6 2.04e-12 72 24 17 496 3 glpK Glycerol kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5P212 2.66e-12 72 26 10 363 3 glpK Glycerol kinase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B9DV90 2.88e-12 72 22 15 472 3 glpK Glycerol kinase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
O34153 3.17e-12 72 22 13 459 1 glpK Glycerol kinase Enterococcus casseliflavus
C6E1L8 3.28e-12 72 25 17 434 3 glpK Glycerol kinase Geobacter sp. (strain M21)
Q9RT38 3.84e-12 72 22 16 453 3 glpK Glycerol kinase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A6WIC0 4.23e-12 72 24 19 491 3 glpK Glycerol kinase Shewanella baltica (strain OS185)
Q49V87 4.29e-12 72 21 16 536 3 araB2 Ribulokinase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8R8J4 4.49e-12 71 22 15 459 3 glpK Glycerol kinase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A3CZL0 4.79e-12 71 24 19 491 3 glpK Glycerol kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1DEK3 4.99e-12 72 22 17 517 2 xkiA Probable D-xylulose kinase A Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q4J7A3 5.41e-12 71 23 15 452 3 glpK2 Glycerol kinase 2 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
B0K643 5.75e-12 71 22 14 458 3 glpK Glycerol kinase Thermoanaerobacter sp. (strain X514)
B8E4K9 6.41e-12 71 24 15 451 3 glpK Glycerol kinase Shewanella baltica (strain OS223)
Q9KCM0 7.18e-12 71 24 3 233 3 rhaB Rhamnulokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4YLX6 7.36e-12 71 25 17 464 3 glpK Glycerol kinase Bradyrhizobium sp. (strain ORS 278)
A0KIT3 7.69e-12 71 25 18 454 3 glpK Glycerol kinase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B8CW97 9.07e-12 70 23 17 446 3 glpK Glycerol kinase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q07K31 9.5e-12 70 26 17 461 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain BisA53)
Q8NLP9 1.04e-11 70 22 13 465 3 glpK Glycerol kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QHT1 1.04e-11 70 22 13 465 3 glpK Glycerol kinase Corynebacterium glutamicum (strain R)
B7N2R7 1.09e-11 70 22 13 452 3 glpK Glycerol kinase Escherichia coli O81 (strain ED1a)
B7UNP6 1.21e-11 70 22 13 452 3 glpK Glycerol kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7NC65 1.22e-11 70 23 23 506 3 glpK Glycerol kinase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B8H8T1 1.28e-11 70 23 15 441 3 glpK Glycerol kinase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A1S2E6 1.29e-11 70 24 15 448 3 glpK Glycerol kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q31KC7 1.42e-11 70 25 9 298 1 PSK D-ribulose kinase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7W3R1 1.43e-11 70 26 19 446 3 glpK Glycerol kinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF38 1.43e-11 70 26 19 446 3 glpK Glycerol kinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A8AVX5 1.44e-11 70 23 16 472 3 glpK Glycerol kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q65GC1 1.45e-11 70 21 14 494 3 araB Ribulokinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9CG64 1.46e-11 70 21 13 458 3 glpK Glycerol kinase Lactococcus lactis subsp. lactis (strain IL1403)
B0K754 1.66e-11 70 22 14 458 3 glpK Glycerol kinase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A9KY18 1.68e-11 70 23 18 490 3 glpK Glycerol kinase Shewanella baltica (strain OS195)
B9KRP4 1.83e-11 69 24 16 454 3 glpK Glycerol kinase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
P57944 1.93e-11 69 23 17 461 3 glpK Glycerol kinase Pasteurella multocida (strain Pm70)
Q7UB84 2.02e-11 69 22 13 452 3 glpK Glycerol kinase Shigella flexneri
Q1QR91 2.15e-11 69 25 19 455 3 glpK Glycerol kinase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A1W309 2.3e-11 69 23 18 512 3 glpK Glycerol kinase Acidovorax sp. (strain JS42)
B7NU81 2.52e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q31U64 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Shigella boydii serotype 4 (strain Sb227)
B1LNM9 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli (strain SMS-3-5 / SECEC)
B7NFM3 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6F3 2.54e-11 69 22 13 452 1 glpK Glycerol kinase Escherichia coli (strain K12)
B1IVF3 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TAD8 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A731 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O9:H4 (strain HS)
B1XB92 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli (strain K12 / DH10B)
C5A093 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B5YZ64 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6F4 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O157:H7
B7LA23 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli (strain 55989 / EAEC)
B7MI58 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZUE0 2.54e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
C3MG71 2.58e-11 69 25 20 454 3 glpK Glycerol kinase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9C0U6 2.69e-11 69 20 16 505 3 xks1 Xylulose kinase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O86033 2.92e-11 69 24 18 453 1 glpK Glycerol kinase Rhizobium meliloti (strain 1021)
Q8Z2Y6 3.02e-11 69 22 15 454 3 glpK Glycerol kinase Salmonella typhi
Q8FBC3 3.14e-11 69 22 13 452 3 glpK Glycerol kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LUS9 3.52e-11 68 22 13 452 3 glpK Glycerol kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0A923 3.56e-11 68 24 15 437 3 glpK Glycerol kinase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4SPA7 4.6e-11 68 24 18 454 3 glpK Glycerol kinase Aeromonas salmonicida (strain A449)
A6W2C1 4.66e-11 68 23 17 459 3 glpK Glycerol kinase Marinomonas sp. (strain MWYL1)
C3KBM0 4.7e-11 68 22 15 453 3 glpK Glycerol kinase Pseudomonas fluorescens (strain SBW25)
B2TWC2 4.75e-11 68 22 13 452 3 glpK Glycerol kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q2SSQ8 4.95e-11 68 23 15 451 3 glpK Glycerol kinase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q03DS8 5.16e-11 68 23 16 470 3 glpK Glycerol kinase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
O87924 5.38e-11 68 23 16 453 3 glpK Glycerol kinase Pseudomonas tolaasii
B7M6X7 5.66e-11 68 22 13 452 3 glpK Glycerol kinase Escherichia coli O8 (strain IAI1)
Q18JE8 6.18e-11 68 24 16 474 3 glpK Glycerol kinase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A5ES06 6.61e-11 68 25 17 464 3 glpK Glycerol kinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
P44399 6.97e-11 68 21 15 458 3 fucK L-fuculokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88ZF1 7.1e-11 68 22 14 449 3 glpK1 Glycerol kinase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q7VSU7 7.6e-11 68 25 19 446 3 glpK Glycerol kinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8CSS0 7.66e-11 67 23 18 483 3 glpK Glycerol kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPP1 7.66e-11 67 23 18 483 3 glpK Glycerol kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A1R6X6 8.23e-11 67 23 17 448 3 glpK Glycerol kinase Paenarthrobacter aurescens (strain TC1)
Q48RX6 8.3e-11 67 22 13 452 3 glpK Glycerol kinase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A3CPV3 8.79e-11 67 22 15 475 3 glpK Glycerol kinase Streptococcus sanguinis (strain SK36)
Q8Y6Z2 9.5e-11 67 23 17 460 3 glpK Glycerol kinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q32A92 9.6e-11 67 22 13 452 3 glpK Glycerol kinase Shigella dysenteriae serotype 1 (strain Sd197)
B2G7U6 9.64e-11 67 22 17 461 3 glpK Glycerol kinase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKE8 9.64e-11 67 22 17 461 3 glpK Glycerol kinase Limosilactobacillus reuteri (strain DSM 20016)
A7Z2U3 9.65e-11 67 21 14 465 3 glpK Glycerol kinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q3J317 9.76e-11 67 24 16 454 3 glpK Glycerol kinase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q71ZD2 9.93e-11 67 23 17 460 3 glpK Glycerol kinase Listeria monocytogenes serotype 4b (strain F2365)
C1KVI5 9.93e-11 67 23 17 460 3 glpK Glycerol kinase Listeria monocytogenes serotype 4b (strain CLIP80459)
B5XMM6 9.98e-11 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RD27 9.98e-11 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JFJ5 9.98e-11 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JKK3 9.98e-11 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAF2 9.98e-11 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q99YI7 9.98e-11 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M1
C4XGV9 1.07e-10 67 22 14 453 3 glpK Glycerol kinase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A5UU55 1.09e-10 67 22 13 447 3 glpK Glycerol kinase Roseiflexus sp. (strain RS-1)
P0DA17 1.12e-10 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA16 1.12e-10 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q63060 1.12e-10 67 22 16 494 2 Gk Glycerol kinase Rattus norvegicus
A8AL00 1.18e-10 67 22 14 453 3 glpK Glycerol kinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TPU7 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella schwarzengrund (strain CVM19633)
B5BJK3 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella paratyphi A (strain AKU_12601)
C0Q436 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella paratyphi C (strain RKS4594)
A9MZH4 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIS3 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0T2 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella newport (strain SL254)
B4TCM2 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella heidelberg (strain SL476)
B5RF85 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXL5 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella enteritidis PT4 (strain P125109)
B5FPT4 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella dublin (strain CT_02021853)
Q57HD1 1.2e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella choleraesuis (strain SC-B67)
B5F0R7 1.25e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella agona (strain SL483)
B8DHL0 1.33e-10 67 23 16 459 3 glpK Glycerol kinase Listeria monocytogenes serotype 4a (strain HCC23)
B0TWZ7 1.39e-10 67 22 16 481 3 glpK Glycerol kinase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q8ZKP3 1.44e-10 67 21 15 454 3 glpK Glycerol kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5XAJ9 1.47e-10 67 23 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P32189 1.6e-10 67 22 16 497 1 GK Glycerol kinase Homo sapiens
Q87BZ2 1.62e-10 67 22 16 494 3 glpK Glycerol kinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I618 1.62e-10 67 22 16 494 3 glpK Glycerol kinase Xylella fastidiosa (strain M23)
Q88YD9 1.62e-10 67 21 14 451 3 glpK2 Glycerol kinase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q07WH4 1.63e-10 67 23 17 478 3 glpK Glycerol kinase Shewanella frigidimarina (strain NCIMB 400)
A0AIY7 1.64e-10 67 23 16 459 3 glpK Glycerol kinase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9PB76 1.68e-10 67 22 15 462 3 glpK Glycerol kinase Xylella fastidiosa (strain 9a5c)
Q92BH6 1.7e-10 67 23 16 459 3 glpK Glycerol kinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q64516 1.75e-10 67 22 16 494 1 Gk Glycerol kinase Mus musculus
B1KKY8 1.77e-10 66 24 17 456 3 glpK Glycerol kinase Shewanella woodyi (strain ATCC 51908 / MS32)
B2RZV0 1.85e-10 66 22 16 462 3 glpK Glycerol kinase Borrelia hermsii (strain HS1 / DAH)
A9MI40 2.35e-10 66 21 15 454 3 glpK Glycerol kinase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q5V4I4 3.25e-10 65 23 18 479 3 glpK Glycerol kinase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q0IID9 3.62e-10 65 23 17 494 2 GK Glycerol kinase Bos taurus
A8FQ89 3.73e-10 65 24 21 483 3 glpK Glycerol kinase Shewanella sediminis (strain HAW-EB3)
B0U3F2 3.76e-10 65 22 16 494 3 glpK Glycerol kinase Xylella fastidiosa (strain M12)
Q6FDN3 3.9e-10 65 24 19 466 3 glpK Glycerol kinase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6AGR0 3.95e-10 65 23 16 442 3 glpK Glycerol kinase Leifsonia xyli subsp. xyli (strain CTCB07)
Q8EVD0 4.21e-10 65 21 14 456 3 glpK Glycerol kinase Malacoplasma penetrans (strain HF-2)
B5XTD4 4.21e-10 65 22 15 454 3 glpK Glycerol kinase Klebsiella pneumoniae (strain 342)
Q7UTP4 4.3e-10 65 23 18 474 3 glpK Glycerol kinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P63550 4.37e-10 65 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain N315)
P63549 4.37e-10 65 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WYY2 4.37e-10 65 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YSA9 5.64e-10 65 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9X6C9 5.9e-10 65 23 15 453 3 glpK Glycerol kinase Thermus brockianus
Q1J5E4 6.54e-10 65 22 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q8NZW9 7.08e-10 65 22 15 454 3 glpK Glycerol kinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
A3PJB4 8.57e-10 64 24 16 454 3 glpK Glycerol kinase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q1CXI5 8.85e-10 64 23 13 405 3 glpK Glycerol kinase Myxococcus xanthus (strain DK1622)
Q8NXY1 9.05e-10 64 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain MW2)
Q6GBT5 9.05e-10 64 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain MSSA476)
B8ZQ22 9.36e-10 64 21 15 465 3 glpK Glycerol kinase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q49ZR6 9.52e-10 64 22 18 545 3 araB1 Ribulokinase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A6QEK4 9.62e-10 64 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain Newman)
Q5HIC3 9.62e-10 64 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain COL)
Q2G0M6 9.62e-10 64 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ88 9.62e-10 64 21 20 543 3 araB Ribulokinase Staphylococcus aureus (strain USA300)
Q13UE3 9.89e-10 64 22 16 457 3 glpK Glycerol kinase Paraburkholderia xenovorans (strain LB400)
Q4L607 1.09e-09 64 23 16 452 3 glpK Glycerol kinase Staphylococcus haemolyticus (strain JCSC1435)
C1CBG2 1.32e-09 63 22 14 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain 70585)
A6TFR2 1.4e-09 63 21 15 454 3 glpK Glycerol kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q65M11 1.62e-09 63 22 14 460 3 glpK Glycerol kinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q98M73 1.85e-09 63 23 15 451 3 glpK Glycerol kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q47ER3 1.94e-09 63 25 18 462 3 glpK Glycerol kinase Dechloromonas aromatica (strain RCB)
Q828K5 2.1e-09 63 22 14 443 3 glpK1 Glycerol kinase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B2SYH7 2.16e-09 63 22 16 457 3 glpK Glycerol kinase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A9BRV2 2.33e-09 63 24 18 503 3 glpK Glycerol kinase Delftia acidovorans (strain DSM 14801 / SPH-1)
B8J0H2 2.35e-09 63 24 14 452 3 glpK Glycerol kinase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B2JD95 2.76e-09 63 22 15 456 3 glpK Glycerol kinase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1K962 2.77e-09 63 23 13 406 3 glpK Glycerol kinase Azoarcus sp. (strain BH72)
D4GYI5 2.82e-09 63 22 16 451 2 glpK Glycerol kinase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
C1CNF8 2.85e-09 63 21 14 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain P1031)
B1I9Z6 2.88e-09 63 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain Hungary19A-6)
Q165D5 3.21e-09 62 24 17 460 3 glpK Glycerol kinase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q10Y19 3.29e-09 62 22 18 443 3 glpK Glycerol kinase Trichodesmium erythraeum (strain IMS101)
B5E3S7 3.37e-09 62 21 14 453 3 glpK Glycerol kinase Streptococcus pneumoniae serotype 19F (strain G54)
A4J8E6 4.04e-09 62 22 16 450 3 glpK Glycerol kinase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C1CUA3 5.22e-09 62 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CHI6 5.22e-09 62 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain JJA)
P63743 5.22e-09 62 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2INK5 5.22e-09 62 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae (strain CGSP14)
P63742 5.22e-09 62 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HZ0 5.22e-09 62 22 15 453 3 glpK Glycerol kinase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B1LWN6 5.4e-09 62 21 14 456 3 glpK Glycerol kinase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q5LWR1 5.41e-09 62 23 17 461 3 glpK Glycerol kinase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q3AB25 5.48e-09 62 23 20 489 3 glpK Glycerol kinase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q133H2 5.83e-09 62 24 17 474 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain BisB5)
B9EBI8 6.17e-09 62 23 16 459 3 glpK Glycerol kinase Macrococcus caseolyticus (strain JCSC5402)
Q9ADA7 6.22e-09 62 23 18 447 3 glpK2 Glycerol kinase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C5C1C4 6.77e-09 62 23 16 460 3 glpK Glycerol kinase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A8H995 7.49e-09 61 23 17 453 3 glpK Glycerol kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9M8L4 7.59e-09 61 22 17 462 1 GLPK Glycerol kinase Arabidopsis thaliana
B9JZR4 8.24e-09 61 24 16 457 3 glpK Glycerol kinase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q4QMM7 8.32e-09 61 21 17 462 3 glpK Glycerol kinase Haemophilus influenzae (strain 86-028NP)
A4WG72 8.38e-09 61 21 15 454 3 glpK Glycerol kinase Enterobacter sp. (strain 638)
Q14410 8.44e-09 61 21 17 522 1 GK2 Glycerol kinase 2 Homo sapiens
Q4R4D5 8.81e-09 61 21 16 519 2 GK2 Glycerol kinase 2 Macaca fascicularis
B2UF87 1.02e-08 61 23 14 455 3 glpK Glycerol kinase Ralstonia pickettii (strain 12J)
A5UE44 1.28e-08 60 22 17 461 3 glpK Glycerol kinase Haemophilus influenzae (strain PittEE)
P44400 1.41e-08 60 22 16 460 3 glpK Glycerol kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B2A2C4 1.54e-08 60 20 12 449 3 glpK Glycerol kinase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q96C11 1.58e-08 60 22 20 553 1 FGGY FGGY carbohydrate kinase domain-containing protein Homo sapiens
A9WS93 1.74e-08 60 24 17 449 3 glpK Glycerol kinase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
C0QVC0 1.93e-08 60 22 16 460 3 glpK Glycerol kinase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q2YIQ1 1.96e-08 60 25 15 459 1 eryA Erythritol kinase Brucella abortus (strain 2308)
O05262 2.23e-08 60 23 7 292 3 rhaB Rhamnulokinase Bacillus subtilis (strain 168)
P54271 2.29e-08 57 30 2 135 3 xylB Xylulose kinase (Fragment) Actinoplanes sp. (strain ATCC 31351 / 3876)
Q5HLQ6 2.48e-08 60 19 17 555 3 araB Ribulokinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A7IJ56 2.83e-08 59 24 15 455 3 glpK Glycerol kinase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q9WU65 2.89e-08 60 21 14 440 1 Gk2 Glycerol kinase 2 Mus musculus
Q9NJP9 2.9e-08 59 21 16 464 1 GK Glycerol kinase, glycosomal Trypanosoma brucei brucei
Q8CRC6 3.06e-08 59 19 17 555 3 araB Ribulokinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8XUY1 3.1e-08 59 24 15 455 3 glpK Glycerol kinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6GJB6 3.2e-08 59 20 20 543 3 araB Ribulokinase Staphylococcus aureus (strain MRSA252)
Q14409 3.44e-08 59 22 17 497 1 GK3 Glycerol kinase 3 Homo sapiens
A8ALN9 3.82e-08 59 25 15 327 3 araB Ribulokinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A5UHH7 4.02e-08 59 21 17 461 3 glpK Glycerol kinase Haemophilus influenzae (strain PittGG)
B2VEQ9 4.44e-08 59 25 12 307 3 araB Ribulokinase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q21944 4.46e-08 59 22 19 456 3 R11F4.1 Probable glycerol kinase Caenorhabditis elegans
B8CM45 4.84e-08 58 23 16 475 3 glpK Glycerol kinase Shewanella piezotolerans (strain WP3 / JCM 13877)
B5BL44 5.37e-08 58 24 13 307 3 araB Ribulokinase Salmonella paratyphi A (strain AKU_12601)
Q5PDF1 5.37e-08 58 24 13 307 3 araB Ribulokinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q88S49 5.43e-08 58 25 7 259 3 rhaB Rhamnulokinase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P58542 5.61e-08 58 24 13 307 3 araB Ribulokinase Salmonella typhi
A5VUC1 5.62e-08 58 23 19 467 3 glpK Glycerol kinase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBR2 5.62e-08 58 23 19 467 3 glpK Glycerol kinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MB89 5.62e-08 58 23 19 467 3 glpK Glycerol kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A5EWH1 5.96e-08 58 24 18 458 3 glpK Glycerol kinase Dichelobacter nodosus (strain VCS1703A)
B6IQI0 6.13e-08 58 23 16 453 3 glpK Glycerol kinase Rhodospirillum centenum (strain ATCC 51521 / SW)
A9WYC6 6.13e-08 58 23 19 467 3 glpK Glycerol kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q5NIE5 6.17e-08 58 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JU8 6.17e-08 58 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. tularensis (strain FSC 198)
A4IW85 6.5e-08 58 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q880 7.14e-08 58 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. novicida (strain U112)
A1WKB4 7.51e-08 58 24 15 397 3 glpK Glycerol kinase Verminephrobacter eiseniae (strain EF01-2)
B5Y1Y0 7.55e-08 58 24 15 326 3 araB Ribulokinase Klebsiella pneumoniae (strain 342)
Q8FWK8 8.04e-08 58 23 19 467 3 glpK Glycerol kinase Brucella suis biovar 1 (strain 1330)
A5G146 8.87e-08 58 22 12 455 3 glpK Glycerol kinase Acidiphilium cryptum (strain JF-5)
A1VA10 9.15e-08 58 22 14 412 3 glpK Glycerol kinase Nitratidesulfovibrio vulgaris (strain DP4)
Q726H4 9.15e-08 58 22 14 412 3 glpK Glycerol kinase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C4LGQ3 9.2e-08 58 22 16 461 3 glpK Glycerol kinase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B2SF32 9.22e-08 58 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. mediasiatica (strain FSC147)
A5VE44 9.24e-08 58 23 12 455 3 glpK Glycerol kinase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B7NHG9 9.27e-08 58 25 18 336 3 araB Ribulokinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q316D5 9.82e-08 58 22 15 400 3 glpK Glycerol kinase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8E9N7 1.01e-07 58 23 15 451 3 glpK Glycerol kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6MJQ2 1.08e-07 58 23 19 474 3 glpK Glycerol kinase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A9MQF0 1.1e-07 58 24 14 307 3 araB Ribulokinase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q65Q24 1.13e-07 57 22 2 196 3 rhaB Rhamnulokinase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B2IE09 1.18e-07 57 23 17 454 3 glpK Glycerol kinase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q6G9R3 1.36e-07 57 21 16 455 3 glpK Glycerol kinase Staphylococcus aureus (strain MSSA476)
Q4J9R1 1.41e-07 57 21 14 401 3 glpK1 Glycerol kinase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q0BKK9 1.47e-07 57 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1W9 1.47e-07 57 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. holarctica (strain LVS)
A7NE12 1.47e-07 57 21 19 482 3 glpK Glycerol kinase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
C6C1M7 1.48e-07 57 22 18 463 3 glpK Glycerol kinase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q71VR3 1.72e-07 57 23 10 315 3 rhaB Rhamnulokinase Listeria monocytogenes serotype 4b (strain F2365)
Q6D4W6 1.79e-07 57 25 12 309 3 araB Ribulokinase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B4SU24 1.93e-07 57 24 13 307 3 araB Ribulokinase Salmonella newport (strain SL254)
A8Z1X0 2.01e-07 57 22 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain USA300 / TCH1516)
A6QGJ8 2.01e-07 57 22 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain Newman)
Q5HGD2 2.01e-07 57 22 17 455 1 glpK Glycerol kinase Staphylococcus aureus (strain COL)
Q2FYZ5 2.01e-07 57 22 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHD9 2.01e-07 57 22 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain USA300)
Q1RGD6 2.12e-07 57 25 18 336 3 araB Ribulokinase Escherichia coli (strain UTI89 / UPEC)
A1A7B0 2.12e-07 57 25 18 336 3 araB Ribulokinase Escherichia coli O1:K1 / APEC
B7MAI6 2.12e-07 57 25 18 336 3 araB Ribulokinase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TLS7 2.22e-07 57 26 19 336 3 araB Ribulokinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q81U58 2.31e-07 57 23 11 332 3 glpK Glycerol kinase Bacillus anthracis
C3P2T3 2.31e-07 57 23 11 332 3 glpK Glycerol kinase Bacillus anthracis (strain A0248)
Q67Q63 2.36e-07 57 20 12 450 3 glpK Glycerol kinase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q6N3I8 2.41e-07 57 24 14 475 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A5CS23 2.47e-07 57 22 18 443 3 glpK Glycerol kinase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q8NWX7 2.57e-07 57 21 16 455 3 glpK Glycerol kinase Staphylococcus aureus (strain MW2)
B2FI02 2.58e-07 57 22 12 450 3 glpK Glycerol kinase Stenotrophomonas maltophilia (strain K279a)
B5F784 2.64e-07 57 24 13 307 3 araB Ribulokinase Salmonella agona (strain SL483)
Q83MG5 2.71e-07 57 25 17 330 3 araB Ribulokinase Shigella flexneri
A6T4K1 2.71e-07 57 23 15 326 3 araB Ribulokinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q66AF7 2.82e-07 56 26 13 297 3 araB Ribulokinase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7MYB6 2.87e-07 56 22 15 454 3 glpK Glycerol kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4SJT3 3.07e-07 56 22 14 450 3 glpK Glycerol kinase Stenotrophomonas maltophilia (strain R551-3)
Q6GHD5 3.34e-07 56 21 16 455 3 glpK Glycerol kinase Staphylococcus aureus (strain MRSA252)
B1LFZ7 3.54e-07 56 25 18 336 3 araB Ribulokinase Escherichia coli (strain SMS-3-5 / SECEC)
B7N7T7 3.54e-07 56 25 18 336 3 araB Ribulokinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B4TWU9 3.56e-07 56 24 13 307 3 araB Ribulokinase Salmonella schwarzengrund (strain CVM19633)
Q2YXR6 3.71e-07 56 21 16 455 3 glpK Glycerol kinase Staphylococcus aureus (strain bovine RF122 / ET3-1)
C5CSQ9 3.74e-07 56 22 16 498 3 glpK Glycerol kinase Variovorax paradoxus (strain S110)
A2AJL3 3.88e-07 56 22 21 553 1 Fggy FGGY carbohydrate kinase domain-containing protein Mus musculus
A8I8V7 3.98e-07 56 22 15 453 3 glpK Glycerol kinase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B3QH88 4.03e-07 56 24 14 475 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain TIE-1)
Q8U940 4.16e-07 56 23 18 462 3 glpK Glycerol kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
B7K2C0 4.21e-07 56 22 20 464 3 glpK Glycerol kinase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q2RST6 4.25e-07 56 21 12 438 3 glpK Glycerol kinase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
P99113 4.31e-07 56 21 17 455 1 glpK Glycerol kinase Staphylococcus aureus (strain N315)
P63741 4.31e-07 56 21 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISI2 4.31e-07 56 21 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain JH9)
A6U1B8 4.31e-07 56 21 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain JH1)
A7X1U3 4.31e-07 56 21 17 455 3 glpK Glycerol kinase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B0TQM6 4.31e-07 56 23 18 479 3 glpK Glycerol kinase Shewanella halifaxensis (strain HAW-EB4)
B9J7X6 4.74e-07 55 23 19 479 3 glpK Glycerol kinase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q11HY2 4.92e-07 55 23 18 473 3 glpK Glycerol kinase Chelativorans sp. (strain BNC1)
B8DCW1 5.06e-07 55 23 10 315 3 rhaB Rhamnulokinase Listeria monocytogenes serotype 4a (strain HCC23)
C1L0I2 5.47e-07 55 23 10 315 3 rhaB Rhamnulokinase Listeria monocytogenes serotype 4b (strain CLIP80459)
A4FNR2 5.61e-07 55 21 12 440 3 glpK Glycerol kinase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B9IT52 5.98e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus cereus (strain Q1)
Q6HMD5 6.25e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HYU3 6.25e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus cereus (strain AH187)
B7JCV9 6.25e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus cereus (strain AH820)
C3LCY4 6.25e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus anthracis (strain CDC 684 / NRRL 3495)
O66746 6.55e-07 55 22 17 458 3 glpK Glycerol kinase Aquifex aeolicus (strain VF5)
Q63EX2 6.59e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus cereus (strain ZK / E33L)
C1EKE4 6.59e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus cereus (strain 03BB102)
A0RAP3 6.59e-07 55 23 11 332 3 glpK Glycerol kinase Bacillus thuringiensis (strain Al Hakam)
B7M0F8 7.05e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli O8 (strain IAI1)
Q926R0 8.04e-07 55 23 10 315 3 rhaB Rhamnulokinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B4TJ60 8.41e-07 55 23 13 307 3 araB Ribulokinase Salmonella heidelberg (strain SL476)
A6LCZ1 8.6e-07 55 22 16 453 3 glpK Glycerol kinase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q3Z5U8 8.84e-07 55 25 17 330 3 araB Ribulokinase Shigella sonnei (strain Ss046)
P06188 8.94e-07 55 23 13 307 3 araB Ribulokinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A7ZW13 9.23e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli O9:H4 (strain HS)
B7L4I4 9.23e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli (strain 55989 / EAEC)
Q1CIX8 9.32e-07 55 26 11 253 3 araB Ribulokinase Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C7J2 9.32e-07 55 26 11 253 3 araB Ribulokinase Yersinia pestis bv. Antiqua (strain Antiqua)
Q0T8D4 9.47e-07 55 25 17 330 3 araB Ribulokinase Shigella flexneri serotype 5b (strain 8401)
B2U269 9.56e-07 55 25 18 336 3 araB Ribulokinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6HZ43 9.56e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli (strain SE11)
C4ZPY6 9.72e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZHF4 9.81e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli O139:H28 (strain E24377A / ETEC)
P58543 9.86e-07 55 26 11 253 3 araB Ribulokinase Yersinia pestis
B1IRB5 9.98e-07 55 25 18 336 3 araB Ribulokinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A4T5Y1 1.03e-06 55 23 17 460 3 glpK Glycerol kinase Mycolicibacterium gilvum (strain PYR-GCK)
Q73CE0 1.1e-06 54 23 11 332 3 glpK Glycerol kinase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q326H2 1.17e-06 54 25 18 336 3 araB Ribulokinase Shigella boydii serotype 4 (strain Sb227)
B5YZ99 1.2e-06 54 25 18 336 3 araB Ribulokinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58541 1.2e-06 54 25 18 336 3 araB Ribulokinase Escherichia coli O157:H7
P08204 1.25e-06 54 25 18 336 1 araB Ribulokinase Escherichia coli (strain K12)
A4W6G7 1.3e-06 54 25 13 302 3 araB Ribulokinase Enterobacter sp. (strain 638)
C6DH20 1.45e-06 54 23 10 311 3 araB Ribulokinase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q32K30 1.48e-06 54 25 19 336 3 araB Ribulokinase Shigella dysenteriae serotype 1 (strain Sd197)
A9QYS1 1.82e-06 53 27 3 164 3 rhaB Rhamnulokinase Yersinia pestis bv. Antiqua (strain Angola)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09170
Feature type CDS
Gene xylB
Product xylulokinase
Location 1919472 - 1920983 (strand: 1)
Length 1512 (nucleotides) / 503 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_48
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00370 FGGY family of carbohydrate kinases, N-terminal domain
PF02782 FGGY family of carbohydrate kinases, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1070 Carbohydrate transport and metabolism (G) G Sugar (pentulose or hexulose) kinase

Kegg Ortholog Annotation(s)

Protein Sequence

MTLYAGIDCGTQSTKVIIVDSQTACILGEGSAPHLIISESGGRREQEAKWWTDALETAFAQAIRSAGIDGREIRALSVSGQQHGFVPVSENGDVLAPAKLWCDTSTNAENQWFIDALGGEKAAIERLGLLPQTGYTVSKIIWFKQQHPQLWQQLRHVLLPHDYLNFWLTGNACAEFGDASGTGLLNIRTRQWDKEAADLIDPEGILWQALPPLVRAEQMIGTVRPEIAEKLGISPQTRVASGGGDNMMAAIGTGNIKPGITTMSLGTSGTLFTFAEKPVVADSAMIAGFCSSSNGWMPLICTMNVTSATSTIQSLLGLDIQSFNDALNSSKPGADGLIMLPFFNGERVPQLPDARASLHNMDGSNLTPQNLSLAVVESATYGLRFGIDLFRQQGVTTREIRLTGGGARSAKWRQIVADIMATPVVCVTNQEAAALGAAVQAIWSDTLTTETTPETQLAALCERFVQLDENTRTQPDPVNVPVYESLYQNYLTLLTSEYPEVTL

Flanking regions ( +/- flanking 50bp)

CCGAAGGCCGCGCGACCGACGTGAAAATCGTGCTGGAAATGGAGTAACACATGACGCTCTATGCCGGTATCGACTGCGGAACGCAAAGCACCAAGGTCATTATTGTCGATAGCCAGACTGCCTGCATTTTAGGTGAGGGCAGCGCGCCTCACCTGATTATCAGTGAGTCAGGCGGACGCCGTGAACAGGAAGCCAAATGGTGGACTGATGCACTGGAAACGGCTTTTGCACAGGCAATCCGCAGTGCCGGCATTGACGGGCGTGAGATCCGCGCCCTGTCTGTTTCCGGTCAGCAGCACGGTTTTGTGCCGGTCAGTGAAAACGGTGACGTGCTTGCCCCGGCAAAGTTATGGTGTGATACCTCTACAAATGCAGAAAACCAGTGGTTTATCGATGCGCTGGGCGGTGAAAAAGCGGCGATTGAGCGCCTCGGGTTACTACCGCAGACCGGTTATACCGTTTCAAAAATCATCTGGTTTAAGCAGCAGCATCCGCAACTCTGGCAGCAACTGCGCCATGTGTTGTTACCGCACGATTATCTGAATTTCTGGCTCACCGGCAATGCCTGTGCAGAGTTCGGCGATGCGTCCGGTACCGGACTGCTGAATATCCGTACCCGCCAATGGGACAAAGAAGCTGCTGACCTTATCGATCCGGAAGGGATTTTATGGCAGGCGCTGCCGCCGTTAGTCCGCGCTGAACAGATGATCGGCACCGTTCGTCCTGAAATCGCTGAAAAACTGGGAATTTCGCCGCAAACCCGCGTGGCATCCGGTGGTGGCGATAACATGATGGCGGCAATCGGTACCGGAAATATCAAACCGGGGATCACCACCATGAGCCTCGGGACATCCGGCACCCTGTTTACCTTTGCTGAGAAACCGGTTGTGGCGGATTCCGCTATGATCGCGGGCTTCTGCTCCTCCAGCAATGGCTGGATGCCACTCATCTGTACGATGAATGTCACATCCGCCACCAGCACTATTCAGTCATTATTAGGACTGGATATTCAGTCCTTTAATGATGCGCTGAACAGCAGTAAACCCGGCGCGGATGGTCTTATCATGCTGCCGTTCTTTAATGGCGAACGCGTACCTCAGTTACCCGATGCCCGCGCCAGCCTGCATAACATGGACGGCAGCAACCTGACACCGCAAAACCTGAGCCTGGCTGTGGTTGAAAGTGCCACATACGGGCTGCGTTTTGGTATCGATCTGTTCCGTCAGCAAGGCGTAACCACCCGCGAAATCCGCCTGACCGGCGGCGGTGCGCGCAGTGCAAAATGGCGTCAGATTGTCGCAGATATCATGGCAACGCCTGTGGTCTGTGTGACCAACCAGGAAGCCGCCGCATTAGGTGCTGCCGTTCAGGCCATCTGGAGCGATACCCTGACCACAGAGACAACGCCGGAAACACAGTTAGCCGCGTTATGTGAACGCTTTGTTCAACTGGATGAAAACACCCGCACGCAGCCGGATCCTGTAAATGTGCCGGTGTATGAATCGCTGTATCAGAATTACCTCACTTTACTGACATCAGAATATCCGGAGGTCACATTATGACGGCATCTGTGGCAGACAATGACGAGTTACTGCGGGTTGAAGGGGTACGC