Homologs in group_48

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02200 FBDBKF_02200 94.2 Morganella morganii S1 lsrK autoinducer-2 kinase
FBDBKF_04695 FBDBKF_04695 26.2 Morganella morganii S1 xylB xylulokinase
EHELCC_02670 EHELCC_02670 94.2 Morganella morganii S2 lsrK autoinducer-2 kinase
EHELCC_05985 EHELCC_05985 26.2 Morganella morganii S2 xylB xylulokinase
NLDBIP_00790 NLDBIP_00790 94.2 Morganella morganii S4 lsrK autoinducer-2 kinase
NLDBIP_06305 NLDBIP_06305 26.2 Morganella morganii S4 xylB xylulokinase
LHKJJB_01245 LHKJJB_01245 94.2 Morganella morganii S3 lsrK autoinducer-2 kinase
LHKJJB_03185 LHKJJB_03185 26.2 Morganella morganii S3 xylB xylulokinase
HKOGLL_01285 HKOGLL_01285 94.2 Morganella morganii S5 lsrK autoinducer-2 kinase
HKOGLL_06660 HKOGLL_06660 26.2 Morganella morganii S5 xylB xylulokinase
F4V73_RS09170 F4V73_RS09170 25.8 Morganella psychrotolerans xylB xylulokinase
PMI_RS06145 PMI_RS06145 25.8 Proteus mirabilis HI4320 xylB xylulokinase

Distribution of the homologs in the orthogroup group_48

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_48

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N2E1 0.0 926 83 0 527 3 lsrK Autoinducer-2 kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JJ57 0.0 920 82 0 529 3 lsrK Autoinducer-2 kinase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLP8 0.0 884 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EY7 0.0 884 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQL2 0.0 884 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pestis (strain Pestoides F)
B2K3G3 0.0 884 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FMJ5 0.0 884 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9R072 0.0 882 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pestis bv. Antiqua (strain Angola)
Q1CN11 0.0 882 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WJP7 0.0 882 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pestis
Q1C142 0.0 882 82 0 525 3 lsrK Autoinducer-2 kinase Yersinia pestis bv. Antiqua (strain Antiqua)
A6TEC0 0.0 867 79 0 519 3 lsrK Autoinducer-2 kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WER6 0.0 864 79 0 518 3 lsrK Autoinducer-2 kinase Enterobacter sp. (strain 638)
Q8Z2X3 0.0 854 78 0 525 3 lsrK Autoinducer-2 kinase Salmonella typhi
Q8ZKQ6 0.0 853 78 0 525 1 lsrK Autoinducer-2 kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MZF8 0.0 852 77 0 525 3 lsrK Autoinducer-2 kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJE9 0.0 850 77 0 525 3 lsrK Autoinducer-2 kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HE4 0.0 849 77 0 525 3 lsrK Autoinducer-2 kinase Salmonella choleraesuis (strain SC-B67)
A7ZLW9 0.0 849 76 0 525 3 lsrK Autoinducer-2 kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
P77432 0.0 848 76 0 525 1 lsrK Autoinducer-2 kinase Escherichia coli (strain K12)
B1XE99 0.0 848 76 0 525 3 lsrK Autoinducer-2 kinase Escherichia coli (strain K12 / DH10B)
B1IRU9 0.0 848 76 0 525 3 lsrK Autoinducer-2 kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A064 0.0 847 76 0 525 3 lsrK Autoinducer-2 kinase Escherichia coli O9:H4 (strain HS)
B1LFA4 0.0 847 76 0 525 3 lsrK Autoinducer-2 kinase Escherichia coli (strain SMS-3-5 / SECEC)
Q8XAY5 0.0 815 76 0 525 3 lsrK Autoinducer-2 kinase Escherichia coli O157:H7
Q8CR47 8.05e-40 154 23 12 517 3 xylB Xylulose kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL88 1.01e-39 154 23 12 517 3 xylB Xylulose kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P21939 3.57e-35 141 24 9 512 3 xylB Xylulose kinase Lactiplantibacillus pentosus
P12011 1.39e-34 139 27 18 478 3 gntK Gluconokinase Bacillus subtilis (strain 168)
Q9RT38 3.52e-34 138 27 20 522 3 glpK Glycerol kinase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P35850 3.98e-33 135 25 13 517 2 xylB Xylulose kinase Levilactobacillus brevis
P46834 4.26e-33 135 26 17 508 3 gntK Gluconokinase Bacillus licheniformis
O34861 2.16e-32 133 23 8 480 2 yoaC Putative sugar kinase YoaC Bacillus subtilis (strain 168)
C5A1M3 7.83e-32 131 27 18 500 3 glpK Glycerol kinase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
C4XGV9 2.86e-31 130 26 17 515 3 glpK Glycerol kinase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q0VRN6 7.89e-31 129 28 21 519 3 glpK Glycerol kinase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B6YT00 8.89e-31 128 26 16 477 3 glpK Glycerol kinase Thermococcus onnurineus (strain NA1)
Q4J7A3 1.32e-30 128 27 17 510 3 glpK2 Glycerol kinase 2 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P39211 1.46e-30 128 20 10 502 3 xylB Xylulose kinase Bacillus subtilis (strain 168)
A6SUL1 2.16e-30 127 28 16 500 3 glpK Glycerol kinase Janthinobacterium sp. (strain Marseille)
P37677 2.2e-30 127 24 14 512 1 lyx L-xylulose/3-keto-L-gulonate kinase Escherichia coli (strain K12)
Q8R8J4 2.39e-30 127 26 17 510 3 glpK Glycerol kinase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A4G1Q7 2.98e-30 127 27 18 508 3 glpK Glycerol kinase Herminiimonas arsenicoxydans
B8DL62 3.47e-30 127 28 20 513 3 glpK Glycerol kinase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q9X1E4 4.04e-30 126 26 21 515 3 glpK2 Glycerol kinase 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7NJT1 4.16e-30 126 29 17 482 3 glpK Glycerol kinase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P57928 5.04e-30 126 24 12 502 3 lyx Probable L-xylulose kinase Pasteurella multocida (strain Pm70)
Q8CSS0 8.92e-30 125 26 21 513 3 glpK Glycerol kinase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPP1 8.92e-30 125 26 21 513 3 glpK Glycerol kinase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O93623 4.19e-29 124 25 16 504 1 glpK Glycerol kinase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P27155 6.55e-29 123 22 12 502 3 xylB Xylulose kinase Staphylococcus xylosus
Q8TZI8 1.13e-28 122 24 21 517 3 glpK Glycerol kinase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9V207 1.73e-28 122 25 18 509 3 glpK Glycerol kinase Pyrococcus abyssi (strain GE5 / Orsay)
A7Z2U3 1.74e-28 122 26 21 515 3 glpK Glycerol kinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5WL06 2.1e-28 122 25 19 556 3 araB Ribulokinase Shouchella clausii (strain KSM-K16)
Q65M11 2.71e-28 121 26 17 499 3 glpK Glycerol kinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2G7U6 3.73e-28 120 24 16 512 3 glpK Glycerol kinase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKE8 3.73e-28 120 24 16 512 3 glpK Glycerol kinase Limosilactobacillus reuteri (strain DSM 20016)
P95907 3.87e-28 120 26 20 498 3 glpK2 Glycerol kinase 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q9CFG8 7.01e-28 120 22 13 514 3 xylB Xylulose kinase Lactococcus lactis subsp. lactis (strain IL1403)
Q749I1 1.52e-27 119 26 17 514 3 glpK Glycerol kinase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1KKY8 2.67e-27 118 26 20 519 3 glpK Glycerol kinase Shewanella woodyi (strain ATCC 51908 / MS32)
C5C1C4 3.2e-27 118 27 20 529 3 glpK Glycerol kinase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A1REY5 5.06e-27 117 28 18 478 3 glpK Glycerol kinase Shewanella sp. (strain W3-18-1)
A4Y2M5 5.06e-27 117 28 18 478 3 glpK Glycerol kinase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C3MUZ1 5.59e-27 117 26 17 479 3 glpK Glycerol kinase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C4KEH1 5.59e-27 117 26 17 479 3 glpK Glycerol kinase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
B0K643 6.95e-27 117 26 16 476 3 glpK Glycerol kinase Thermoanaerobacter sp. (strain X514)
Q87XL0 8.67e-27 117 26 18 520 3 glpK Glycerol kinase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3N2M3 9.71e-27 117 26 17 479 3 glpK Glycerol kinase Sulfolobus islandicus (strain M.16.27)
B8E4K9 1e-26 116 28 18 478 3 glpK Glycerol kinase Shewanella baltica (strain OS223)
A6WIC0 1.24e-26 116 28 18 478 3 glpK Glycerol kinase Shewanella baltica (strain OS185)
A9KY18 1.33e-26 116 28 18 478 3 glpK Glycerol kinase Shewanella baltica (strain OS195)
A3CZL0 1.39e-26 116 28 18 478 3 glpK Glycerol kinase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A2SM29 1.64e-26 116 27 17 515 3 glpK Glycerol kinase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C3NAM2 1.68e-26 116 26 16 480 3 glpK Glycerol kinase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MP45 1.68e-26 116 26 16 480 3 glpK Glycerol kinase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Q3AB25 2.05e-26 115 26 18 513 3 glpK Glycerol kinase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q97XW1 2.74e-26 115 26 16 480 3 glpK1 Glycerol kinase 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C6E1L8 3.45e-26 115 27 18 510 3 glpK Glycerol kinase Geobacter sp. (strain M21)
Q3M3M2 3.46e-26 115 26 18 525 3 glpK Glycerol kinase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B0TQM6 4.36e-26 114 26 18 486 3 glpK Glycerol kinase Shewanella halifaxensis (strain HAW-EB4)
Q48F01 5.51e-26 114 25 18 520 3 glpK Glycerol kinase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q827G1 5.57e-26 114 28 20 521 3 glpK2 Glycerol kinase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q03DS8 5.97e-26 114 25 18 494 3 glpK Glycerol kinase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A1WT61 6.4e-26 114 28 21 512 3 glpK Glycerol kinase Halorhodospira halophila (strain DSM 244 / SL1)
C1DHV0 6.42e-26 114 26 14 479 3 glpK Glycerol kinase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A3QIN4 6.79e-26 114 28 17 477 3 glpK Glycerol kinase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q316D5 7.46e-26 114 25 16 511 3 glpK Glycerol kinase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P18157 7.47e-26 114 24 21 529 1 glpK Glycerol kinase Bacillus subtilis (strain 168)
B3E6Z6 7.98e-26 114 27 19 517 3 glpK Glycerol kinase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A8F679 8.8e-26 114 24 18 522 3 glpK Glycerol kinase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q7NC65 9.62e-26 114 24 19 510 3 glpK Glycerol kinase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q38XX6 1.19e-25 113 24 18 504 3 glpK Glycerol kinase Latilactobacillus sakei subsp. sakei (strain 23K)
P44399 1.33e-25 113 21 13 502 3 fucK L-fuculokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0L1Q5 1.88e-25 113 28 17 473 3 glpK Glycerol kinase Shewanella sp. (strain ANA-3)
A1VA10 1.95e-25 113 27 18 514 3 glpK Glycerol kinase Nitratidesulfovibrio vulgaris (strain DP4)
Q726H4 1.95e-25 113 27 18 514 3 glpK Glycerol kinase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q4ZPI7 1.97e-25 113 25 18 520 3 glpK Glycerol kinase Pseudomonas syringae pv. syringae (strain B728a)
B0K754 2.41e-25 112 26 16 477 3 glpK Glycerol kinase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
P47284 2.48e-25 112 26 19 498 3 glpK Glycerol kinase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q0HE70 2.73e-25 112 27 18 493 3 glpK Glycerol kinase Shewanella sp. (strain MR-4)
Q1WVJ0 2.74e-25 112 25 16 478 3 glpK Glycerol kinase Ligilactobacillus salivarius (strain UCC118)
Q8E9N7 2.94e-25 112 28 17 476 3 glpK Glycerol kinase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8YW05 3.14e-25 112 26 15 483 3 glpK Glycerol kinase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q0HZS9 3.35e-25 112 27 18 493 3 glpK Glycerol kinase Shewanella sp. (strain MR-7)
Q8ZMC5 3.68e-25 112 23 13 491 3 fucK L-fuculokinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9BJ81 4.32e-25 112 26 19 511 3 glpK Glycerol kinase Petrotoga mobilis (strain DSM 10674 / SJ95)
A4XXN1 6.06e-25 111 27 18 505 3 glpK Glycerol kinase Pseudomonas mendocina (strain ymp)
Q9KBQ3 7.1e-25 112 22 16 549 1 araB Ribulokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q39V17 7.49e-25 111 28 16 477 3 glpK Glycerol kinase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4SPA7 7.51e-25 111 26 21 516 3 glpK Glycerol kinase Aeromonas salmonicida (strain A449)
C4ZGB4 1e-24 110 26 21 520 3 glpK Glycerol kinase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
A4IPA2 1.16e-24 111 23 14 549 3 araB Ribulokinase Geobacillus thermodenitrificans (strain NG80-2)
P55138 1.19e-24 110 24 12 503 3 ygcE Uncharacterized sugar kinase YgcE Escherichia coli (strain K12)
A8H995 1.3e-24 110 26 15 476 3 glpK Glycerol kinase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A6M1Y8 1.52e-24 110 25 20 516 3 glpK Glycerol kinase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A1U326 1.61e-24 110 26 20 510 3 glpK Glycerol kinase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B7K2C0 1.79e-24 110 25 14 484 3 glpK Glycerol kinase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8Y6Z2 2.03e-24 110 25 17 489 3 glpK Glycerol kinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71ZD2 2.05e-24 110 25 18 512 3 glpK Glycerol kinase Listeria monocytogenes serotype 4b (strain F2365)
C1KVI5 2.05e-24 110 25 18 512 3 glpK Glycerol kinase Listeria monocytogenes serotype 4b (strain CLIP80459)
B9EBI8 2.31e-24 109 24 18 507 3 glpK Glycerol kinase Macrococcus caseolyticus (strain JCSC5402)
A8Z1X0 2.61e-24 109 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain USA300 / TCH1516)
A6QGJ8 2.61e-24 109 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain Newman)
Q5HGD2 2.61e-24 109 25 23 527 1 glpK Glycerol kinase Staphylococcus aureus (strain COL)
Q2FYZ5 2.61e-24 109 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHD9 2.61e-24 109 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain USA300)
B8DHL0 2.63e-24 109 25 18 512 3 glpK Glycerol kinase Listeria monocytogenes serotype 4a (strain HCC23)
A7GLY7 2.82e-24 109 24 19 527 3 glpK Glycerol kinase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A0KIT3 2.87e-24 109 26 21 516 3 glpK Glycerol kinase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8NWX7 2.91e-24 109 25 22 516 3 glpK Glycerol kinase Staphylococcus aureus (strain MW2)
Q4L607 3.04e-24 109 25 20 513 3 glpK Glycerol kinase Staphylococcus haemolyticus (strain JCSC1435)
Q8ENK7 3.09e-24 109 25 18 502 3 glpK Glycerol kinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B7M6X7 3.22e-24 109 25 18 499 3 glpK Glycerol kinase Escherichia coli O8 (strain IAI1)
Q8Z428 3.35e-24 108 23 13 491 3 fucK L-fuculokinase Salmonella typhi
Q6G9R3 3.37e-24 109 25 22 516 3 glpK Glycerol kinase Staphylococcus aureus (strain MSSA476)
B2UF87 3.95e-24 108 25 16 497 3 glpK Glycerol kinase Ralstonia pickettii (strain 12J)
B7NU81 3.95e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q6GHD5 4.1e-24 108 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain MRSA252)
Q7UB84 4.1e-24 108 25 19 499 3 glpK Glycerol kinase Shigella flexneri
A1W309 4.29e-24 108 26 19 505 3 glpK Glycerol kinase Acidovorax sp. (strain JS42)
A4J8E6 4.42e-24 108 25 17 512 3 glpK Glycerol kinase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8RHZ9 4.5e-24 108 25 21 504 3 glpK Glycerol kinase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5Z175 4.52e-24 108 28 19 521 3 glpK Glycerol kinase Nocardia farcinica (strain IFM 10152)
C0QVC0 4.57e-24 108 25 20 519 3 glpK Glycerol kinase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A4JHM8 4.77e-24 108 26 23 515 3 glpK Glycerol kinase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A0AIY7 4.85e-24 108 25 20 520 3 glpK Glycerol kinase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P11553 5.32e-24 108 23 17 504 1 fucK L-fuculokinase Escherichia coli (strain K12)
B8CM45 5.51e-24 108 26 17 479 3 glpK Glycerol kinase Shewanella piezotolerans (strain WP3 / JCM 13877)
A9VI58 5.63e-24 108 24 19 512 3 glpK Glycerol kinase Bacillus mycoides (strain KBAB4)
P99113 5.66e-24 108 25 23 527 1 glpK Glycerol kinase Staphylococcus aureus (strain N315)
P63741 5.66e-24 108 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISI2 5.66e-24 108 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain JH9)
A6U1B8 5.66e-24 108 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain JH1)
A7X1U3 5.66e-24 108 25 23 527 3 glpK Glycerol kinase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B7N2R7 5.71e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O81 (strain ED1a)
B7UNP6 5.71e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LUS9 6.15e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q2YXR6 6.32e-24 108 24 22 527 3 glpK Glycerol kinase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B9IT52 7.22e-24 108 25 21 523 3 glpK Glycerol kinase Bacillus cereus (strain Q1)
Q31U64 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Shigella boydii serotype 4 (strain Sb227)
B1LNM9 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli (strain SMS-3-5 / SECEC)
B7NFM3 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6F3 7.39e-24 108 25 18 499 1 glpK Glycerol kinase Escherichia coli (strain K12)
B1IVF3 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TAD8 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A731 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O9:H4 (strain HS)
B1XB92 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli (strain K12 / DH10B)
C5A093 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B5YZ64 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6F4 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O157:H7
B7LA23 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli (strain 55989 / EAEC)
B7MI58 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZUE0 7.39e-24 108 25 18 499 3 glpK Glycerol kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q88ZF1 7.54e-24 108 25 18 481 3 glpK1 Glycerol kinase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B5EB79 8.78e-24 108 27 17 513 3 glpK Glycerol kinase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q5KYP6 9.53e-24 108 23 15 551 3 araB Ribulokinase Geobacillus kaustophilus (strain HTA426)
Q92BH6 1.04e-23 107 25 18 512 3 glpK Glycerol kinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7W3R1 1.07e-23 107 26 16 520 3 glpK Glycerol kinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF38 1.07e-23 107 26 16 520 3 glpK Glycerol kinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q6HMD5 1.34e-23 107 25 19 506 3 glpK Glycerol kinase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HYU3 1.34e-23 107 25 19 506 3 glpK Glycerol kinase Bacillus cereus (strain AH187)
B7JCV9 1.34e-23 107 25 19 506 3 glpK Glycerol kinase Bacillus cereus (strain AH820)
C3LCY4 1.34e-23 107 25 19 506 3 glpK Glycerol kinase Bacillus anthracis (strain CDC 684 / NRRL 3495)
B8GC51 1.47e-23 107 27 19 517 3 glpK Glycerol kinase Chloroflexus aggregans (strain MD-66 / DSM 9485)
C0Z5A8 1.6e-23 107 25 14 474 3 glpK Glycerol kinase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q8FBC3 1.68e-23 107 25 18 499 3 glpK Glycerol kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34153 1.71e-23 107 26 20 509 1 glpK Glycerol kinase Enterococcus casseliflavus
Q8XUY1 1.93e-23 107 26 16 514 3 glpK Glycerol kinase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q81GZ2 2.03e-23 107 25 20 511 3 glpK Glycerol kinase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HG04 2.03e-23 107 25 20 511 3 glpK Glycerol kinase Bacillus cereus (strain B4264)
A6TFR2 2.55e-23 106 25 18 498 3 glpK Glycerol kinase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A5VUC1 2.66e-23 106 25 17 496 3 glpK Glycerol kinase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBR2 2.66e-23 106 25 17 496 3 glpK Glycerol kinase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MB89 2.66e-23 106 25 17 496 3 glpK Glycerol kinase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B1YWB2 2.72e-23 106 26 23 515 3 glpK Glycerol kinase Burkholderia ambifaria (strain MC40-6)
Q8FWK8 2.78e-23 106 25 17 496 3 glpK Glycerol kinase Brucella suis biovar 1 (strain 1330)
Q8X6R3 2.79e-23 106 22 17 504 3 fucK L-fuculokinase Escherichia coli O157:H7
Q63EX2 2.85e-23 106 25 19 506 3 glpK Glycerol kinase Bacillus cereus (strain ZK / E33L)
C1EKE4 2.85e-23 106 25 19 506 3 glpK Glycerol kinase Bacillus cereus (strain 03BB102)
A0RAP3 2.85e-23 106 25 19 506 3 glpK Glycerol kinase Bacillus thuringiensis (strain Al Hakam)
B7GGV9 2.99e-23 107 23 15 549 3 araB Ribulokinase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B5XTD4 3.12e-23 106 25 18 498 3 glpK Glycerol kinase Klebsiella pneumoniae (strain 342)
Q32A92 3.25e-23 106 25 18 499 3 glpK Glycerol kinase Shigella dysenteriae serotype 1 (strain Sd197)
Q81U58 3.58e-23 106 25 19 506 3 glpK Glycerol kinase Bacillus anthracis
C3P2T3 3.58e-23 106 25 19 506 3 glpK Glycerol kinase Bacillus anthracis (strain A0248)
Q9S468 3.89e-23 106 23 15 551 3 araB Ribulokinase Geobacillus stearothermophilus
Q8PDI0 3.93e-23 106 26 20 517 3 glpK Glycerol kinase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RMN0 3.93e-23 106 26 20 517 3 glpK Glycerol kinase Xanthomonas campestris pv. campestris (strain B100)
Q47ER3 4.16e-23 105 27 19 508 3 glpK Glycerol kinase Dechloromonas aromatica (strain RCB)
O34154 4.62e-23 105 25 19 518 1 glpK Glycerol kinase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5FHZ6 4.63e-23 105 24 21 517 3 glpK Glycerol kinase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1QVQ3 5.01e-23 105 27 22 503 3 glpK Glycerol kinase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1R6X6 5.2e-23 105 26 18 530 3 glpK Glycerol kinase Paenarthrobacter aurescens (strain TC1)
A9AFH2 5.51e-23 105 26 24 516 3 glpK Glycerol kinase Burkholderia multivorans (strain ATCC 17616 / 249)
B7IKB1 5.62e-23 105 25 19 506 3 glpK Glycerol kinase Bacillus cereus (strain G9842)
Q48RX6 6.18e-23 105 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M28 (strain MGAS6180)
P94524 6.84e-23 105 23 17 550 2 araB Ribulokinase Bacillus subtilis (strain 168)
B2TWC2 7.83e-23 105 25 18 499 3 glpK Glycerol kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0BC36 8.32e-23 105 26 23 515 3 glpK Glycerol kinase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A9WYC6 8.68e-23 105 25 17 496 3 glpK Glycerol kinase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q1BTT7 9.04e-23 105 26 23 515 3 glpK Glycerol kinase Burkholderia orbicola (strain AU 1054)
B1JY43 9.04e-23 105 26 23 515 3 glpK Glycerol kinase Burkholderia orbicola (strain MC0-3)
A0KAA1 9.04e-23 105 26 23 515 3 glpK Glycerol kinase Burkholderia cenocepacia (strain HI2424)
Q4UZR8 9.57e-23 105 26 20 517 3 glpK Glycerol kinase Xanthomonas campestris pv. campestris (strain 8004)
Q7VSU7 1.14e-22 104 26 16 520 3 glpK Glycerol kinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q1IMB2 1.16e-22 104 27 20 495 3 glpK Glycerol kinase Koribacter versatilis (strain Ellin345)
Q12GA2 1.17e-22 104 26 17 484 3 glpK Glycerol kinase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B9LD34 1.17e-22 104 27 19 517 3 glpK Glycerol kinase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A4WG72 1.24e-22 104 25 18 498 3 glpK Glycerol kinase Enterobacter sp. (strain 638)
Q7P1G2 1.4e-22 104 26 24 536 3 glpK Glycerol kinase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B9MBT7 1.49e-22 104 26 19 505 3 glpK Glycerol kinase Acidovorax ebreus (strain TPSY)
Q97JG4 1.65e-22 104 25 19 496 3 glpK Glycerol kinase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0DA17 1.67e-22 104 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA16 1.67e-22 104 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A9WJ21 1.89e-22 103 27 19 517 3 glpK Glycerol kinase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9CG64 2e-22 103 25 17 483 3 glpK Glycerol kinase Lactococcus lactis subsp. lactis (strain IL1403)
B5XMM6 2.16e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M49 (strain NZ131)
A2RD27 2.16e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JFJ5 2.16e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JKK3 2.16e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAF2 2.16e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q99YI7 2.16e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M1
A6W2C1 2.43e-22 103 26 23 520 3 glpK Glycerol kinase Marinomonas sp. (strain MWYL1)
Q8NZW9 2.57e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1J5E4 2.74e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M4 (strain MGAS10750)
A1S2E6 2.8e-22 103 26 17 476 3 glpK Glycerol kinase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5XAJ9 2.99e-22 103 25 18 486 3 glpK Glycerol kinase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
B8H8T1 3.1e-22 103 27 22 534 3 glpK Glycerol kinase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q0TMA0 3.47e-22 103 24 22 516 3 glpK Glycerol kinase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8ZKP3 3.74e-22 103 24 18 499 3 glpK Glycerol kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6LCZ1 3.81e-22 103 25 19 513 3 glpK Glycerol kinase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8MG11 4.15e-22 103 25 22 513 3 glpK Glycerol kinase Alkaliphilus oremlandii (strain OhILAs)
Q0SQ01 4.16e-22 103 23 19 511 3 glpK Glycerol kinase Clostridium perfringens (strain SM101 / Type A)
A9MI40 4.17e-22 103 24 18 499 3 glpK Glycerol kinase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9WS93 4.84e-22 102 25 15 529 3 glpK Glycerol kinase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q07WH4 5.61e-22 102 25 18 491 3 glpK Glycerol kinase Shewanella frigidimarina (strain NCIMB 400)
B8J0H2 5.98e-22 102 24 15 477 3 glpK Glycerol kinase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B9DV90 6.11e-22 102 25 17 486 3 glpK Glycerol kinase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8XHD3 6.22e-22 102 24 22 516 3 glpK Glycerol kinase Clostridium perfringens (strain 13 / Type A)
Q88YD9 6.57e-22 102 25 23 524 3 glpK2 Glycerol kinase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q1CXI5 7.22e-22 102 26 18 514 3 glpK Glycerol kinase Myxococcus xanthus (strain DK1622)
P44991 7.32e-22 102 21 13 473 3 lyx Probable L-xylulose kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0CB70 7.35e-22 102 25 16 489 3 glpK Glycerol kinase Acaryochloris marina (strain MBIC 11017)
A1VJ23 7.47e-22 102 26 16 485 3 glpK Glycerol kinase Polaromonas naphthalenivorans (strain CJ2)
A8FQ89 7.51e-22 102 26 20 488 3 glpK Glycerol kinase Shewanella sediminis (strain HAW-EB3)
B8FXS7 9.04e-22 102 25 19 518 3 glpK Glycerol kinase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q73CE0 1.13e-21 101 25 19 508 3 glpK Glycerol kinase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q98QY9 1.21e-21 101 24 21 528 3 glpK Glycerol kinase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8FLY8 1.3e-21 101 24 20 524 3 glpK Glycerol kinase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B2A2C4 1.4e-21 101 24 17 509 3 glpK Glycerol kinase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B5F0R7 1.54e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella agona (strain SL483)
Q51390 1.79e-21 101 25 19 490 3 glpK2 Glycerol kinase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B4TPU7 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella schwarzengrund (strain CVM19633)
B5BJK3 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella paratyphi A (strain AKU_12601)
C0Q436 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella paratyphi C (strain RKS4594)
A9MZH4 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIS3 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0T2 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella newport (strain SL254)
B4TCM2 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella heidelberg (strain SL476)
B5RF85 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXL5 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella enteritidis PT4 (strain P125109)
B5FPT4 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella dublin (strain CT_02021853)
Q57HD1 1.79e-21 101 24 18 499 3 glpK Glycerol kinase Salmonella choleraesuis (strain SC-B67)
Q8Z2Y6 1.97e-21 100 24 18 499 3 glpK Glycerol kinase Salmonella typhi
Q2T0Z3 2.11e-21 100 25 18 511 3 glpK Glycerol kinase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3BYR0 2.13e-21 100 25 17 504 3 glpK Glycerol kinase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A8AL00 2.38e-21 100 24 18 499 3 glpK Glycerol kinase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5E3S7 2.68e-21 100 25 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae serotype 19F (strain G54)
Q662C3 2.69e-21 100 25 18 516 3 glpK Glycerol kinase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q8E1T0 2.9e-21 100 25 16 484 3 glpK Glycerol kinase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E794 2.9e-21 100 25 16 484 3 glpK Glycerol kinase Streptococcus agalactiae serotype III (strain NEM316)
Q3K3A6 2.9e-21 100 25 16 484 3 glpK Glycerol kinase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
O87924 2.97e-21 100 24 17 515 3 glpK Glycerol kinase Pseudomonas tolaasii
Q7MYB6 3.36e-21 100 25 21 528 3 glpK Glycerol kinase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TKR6 3.57e-21 100 25 19 478 3 glpK Glycerol kinase Alkaliphilus metalliredigens (strain QYMF)
A5EWH1 3.64e-21 100 24 20 499 3 glpK Glycerol kinase Dichelobacter nodosus (strain VCS1703A)
P44401 3.66e-21 100 23 20 516 3 xylB Xylulose kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65GC1 3.83e-21 100 23 18 537 3 araB Ribulokinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8PQG7 4e-21 100 26 17 503 3 glpK Glycerol kinase Xanthomonas axonopodis pv. citri (strain 306)
Q7UTP4 4.6e-21 100 25 15 495 3 glpK Glycerol kinase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B8CW97 4.8e-21 99 24 14 494 3 glpK Glycerol kinase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A5CS23 4.91e-21 99 26 18 533 3 glpK Glycerol kinase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q4J9R1 4.95e-21 99 25 21 518 3 glpK1 Glycerol kinase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q6AGR0 5.36e-21 99 26 18 527 3 glpK Glycerol kinase Leifsonia xyli subsp. xyli (strain CTCB07)
B8ZQ22 5.59e-21 99 25 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q4K734 5.76e-21 99 25 18 499 3 glpK Glycerol kinase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6MTY7 6.27e-21 99 23 17 518 3 glpK Glycerol kinase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q73LE9 6.36e-21 99 24 18 498 3 glpK Glycerol kinase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q63X50 6.69e-21 99 25 17 495 3 glpK Glycerol kinase Burkholderia pseudomallei (strain K96243)
Q0A923 6.74e-21 99 26 15 452 3 glpK Glycerol kinase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B7VQ85 6.75e-21 99 25 19 509 3 glpK Glycerol kinase Vibrio atlanticus (strain LGP32)
Q88NX8 7.48e-21 99 25 18 515 3 glpK Glycerol kinase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8EVD0 7.53e-21 99 23 22 537 3 glpK Glycerol kinase Malacoplasma penetrans (strain HF-2)
Q01V13 1.14e-20 98 27 18 503 3 glpK Glycerol kinase Solibacter usitatus (strain Ellin6076)
O66131 1.14e-20 98 25 18 514 1 glpK Glycerol kinase Thermus thermophilus
C3KBM0 1.17e-20 98 25 19 515 3 glpK Glycerol kinase Pseudomonas fluorescens (strain SBW25)
B2SYH7 1.23e-20 98 24 18 512 3 glpK Glycerol kinase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
P57944 1.38e-20 98 25 16 479 3 glpK Glycerol kinase Pasteurella multocida (strain Pm70)
B0KUG0 1.46e-20 98 25 18 515 3 glpK Glycerol kinase Pseudomonas putida (strain GB-1)
Q10Y19 1.79e-20 98 24 14 483 3 glpK Glycerol kinase Trichodesmium erythraeum (strain IMS101)
B1LWN6 1.79e-20 98 27 17 486 3 glpK Glycerol kinase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B2JD95 1.85e-20 98 25 17 495 3 glpK Glycerol kinase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5V4I4 1.92e-20 98 24 17 506 3 glpK Glycerol kinase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B1I9Z6 2.01e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain Hungary19A-6)
B7J1G9 2.01e-20 97 24 18 516 3 glpK Glycerol kinase Borreliella burgdorferi (strain ZS7)
O51257 2.01e-20 97 24 18 516 3 glpK Glycerol kinase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9ADA7 2.21e-20 97 25 17 518 3 glpK2 Glycerol kinase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q67Q63 2.25e-20 97 24 13 480 3 glpK Glycerol kinase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
C1CNF8 2.3e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain P1031)
Q5L091 2.55e-20 97 25 19 514 3 glpK Glycerol kinase Geobacillus kaustophilus (strain HTA426)
C6C1M7 2.61e-20 97 25 22 523 3 glpK Glycerol kinase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
C1CBG2 2.8e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain 70585)
C5DA06 2.84e-20 97 25 18 515 3 glpK Glycerol kinase Geobacillus sp. (strain WCH70)
Q49X93 2.93e-20 97 22 18 521 3 glpK Glycerol kinase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C1CUA3 3.18e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CHI6 3.18e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain JJA)
P63743 3.18e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2INK5 3.18e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae (strain CGSP14)
P63742 3.18e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HZ0 3.18e-20 97 24 17 479 3 glpK Glycerol kinase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9X6C9 3.55e-20 97 26 18 510 3 glpK Glycerol kinase Thermus brockianus
A7N1R1 3.8e-20 97 24 19 512 3 glpK Glycerol kinase Vibrio campbellii (strain ATCC BAA-1116)
B1Y1L9 3.82e-20 97 27 18 505 3 glpK Glycerol kinase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A5UU55 4.6e-20 96 26 18 528 3 glpK Glycerol kinase Roseiflexus sp. (strain RS-1)
A3CPV3 4.65e-20 96 24 17 479 3 glpK Glycerol kinase Streptococcus sanguinis (strain SK36)
A4FNR2 5e-20 96 25 16 526 3 glpK Glycerol kinase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q3K7I5 5.52e-20 96 25 20 515 3 glpK Glycerol kinase Pseudomonas fluorescens (strain Pf0-1)
P44400 6.19e-20 96 22 18 516 3 glpK Glycerol kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5VZG7 7.07e-20 96 24 18 515 3 glpK Glycerol kinase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9KLJ9 7.22e-20 96 25 16 477 3 glpK Glycerol kinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5FP70 7.53e-20 96 25 23 508 3 glpK Glycerol kinase Gluconobacter oxydans (strain 621H)
Q2SSQ8 8.57e-20 95 24 16 482 3 glpK Glycerol kinase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A1K962 9.91e-20 95 27 18 479 3 glpK Glycerol kinase Azoarcus sp. (strain BH72)
B2TN12 1.12e-19 95 25 21 520 3 glpK Glycerol kinase Clostridium botulinum (strain Eklund 17B / Type B)
A5EZR2 1.18e-19 95 25 16 477 3 glpK Glycerol kinase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LW10 1.27e-19 95 25 16 477 3 glpK Glycerol kinase Vibrio cholerae serotype O1 (strain M66-2)
Q0SNS0 1.31e-19 95 24 18 513 3 glpK Glycerol kinase Borreliella afzelii (strain PKo)
Q1IE16 1.46e-19 95 25 19 515 3 glpK Glycerol kinase Pseudomonas entomophila (strain L48)
A8AVX5 1.87e-19 95 24 17 479 3 glpK Glycerol kinase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A5UHH7 1.91e-19 95 22 18 515 3 glpK Glycerol kinase Haemophilus influenzae (strain PittGG)
Q87BZ2 2.17e-19 94 23 17 493 3 glpK Glycerol kinase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I618 2.17e-19 94 23 17 493 3 glpK Glycerol kinase Xylella fastidiosa (strain M23)
B2V358 2.45e-19 94 25 21 520 3 glpK Glycerol kinase Clostridium botulinum (strain Alaska E43 / Type E3)
Q9PB76 2.74e-19 94 23 17 493 3 glpK Glycerol kinase Xylella fastidiosa (strain 9a5c)
Q83D14 3.11e-19 94 23 18 528 3 glpK Glycerol kinase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KCL1 3.11e-19 94 23 18 528 3 glpK Glycerol kinase Coxiella burnetii (strain Dugway 5J108-111)
A5UE44 3.4e-19 94 22 18 516 3 glpK Glycerol kinase Haemophilus influenzae (strain PittEE)
Q13UE3 3.69e-19 94 24 18 502 3 glpK Glycerol kinase Paraburkholderia xenovorans (strain LB400)
Q9HY41 3.7e-19 94 26 17 486 3 glpK1 Glycerol kinase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9LBQ3 3.83e-19 94 24 14 529 3 araB Ribulokinase Mycolicibacterium smegmatis
B6IQI0 4.02e-19 94 27 18 495 3 glpK Glycerol kinase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q893Q3 5.03e-19 93 25 17 482 3 glpK1 Glycerol kinase 1 Clostridium tetani (strain Massachusetts / E88)
Q7MI93 7.05e-19 93 24 17 479 3 glpK Glycerol kinase Vibrio vulnificus (strain YJ016)
Q8DBM6 7.05e-19 93 24 17 479 3 glpK Glycerol kinase Vibrio vulnificus (strain CMCP6)
A9NCY5 7.31e-19 93 23 17 526 3 glpK Glycerol kinase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q047N5 9.03e-19 92 24 20 511 3 glpK Glycerol kinase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q87M72 9.15e-19 92 24 19 512 3 glpK Glycerol kinase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C1FUW6 9.53e-19 92 25 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain Kyoto / Type A2)
Q11HY2 1.02e-18 92 25 19 525 3 glpK Glycerol kinase Chelativorans sp. (strain BNC1)
Q4QMM7 1.03e-18 92 23 18 515 3 glpK Glycerol kinase Haemophilus influenzae (strain 86-028NP)
C5CSQ9 1.12e-18 92 24 15 494 3 glpK Glycerol kinase Variovorax paradoxus (strain S110)
B2RZV0 1.2e-18 92 26 23 520 3 glpK Glycerol kinase Borrelia hermsii (strain HS1 / DAH)
A5I5M0 1.47e-18 92 24 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FX30 1.47e-18 92 24 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain ATCC 19397 / Type A)
A1SZE1 1.63e-18 92 24 18 505 3 glpK Glycerol kinase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B1IKJ7 1.68e-18 92 24 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain Okra / Type B1)
A7GH02 1.71e-18 92 24 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1KYK0 1.84e-18 92 24 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain Loch Maree / Type A3)
Q5LWR1 1.92e-18 91 24 15 476 3 glpK Glycerol kinase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9NJP9 2.15e-18 91 25 20 477 1 GK Glycerol kinase, glycosomal Trypanosoma brucei brucei
C3L254 2.26e-18 91 24 16 477 3 glpK Glycerol kinase Clostridium botulinum (strain 657 / Type Ba4)
Q9WX53 2.66e-18 91 24 18 513 1 glpK Glycerol kinase Thermus aquaticus
B0U3F2 3.28e-18 91 23 17 493 3 glpK Glycerol kinase Xylella fastidiosa (strain M12)
P9WPK1 3.82e-18 90 25 16 530 1 glpK Glycerol kinase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPK0 3.82e-18 90 25 16 530 3 glpK Glycerol kinase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U920 3.82e-18 90 25 16 530 3 glpK Glycerol kinase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q5E0Z0 4.19e-18 90 24 20 513 3 glpK Glycerol kinase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5RL65 5.9e-18 90 24 19 484 3 glpK Glycerol kinase Borrelia duttonii (strain Ly)
Q18JE8 6.96e-18 90 24 18 515 3 glpK Glycerol kinase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q5P212 9.5e-18 89 27 20 519 3 glpK Glycerol kinase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9KDW8 1.09e-17 89 25 16 511 3 glpK Glycerol kinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q98M73 1.12e-17 89 25 20 501 3 glpK Glycerol kinase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P75064 1.23e-17 89 23 17 519 3 glpK Glycerol kinase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P74260 1.27e-17 89 25 17 489 3 glpK Glycerol kinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8BX05 1.72e-17 89 22 16 544 1 Gk5 Glycerol kinase 5 Mus musculus
O86033 1.75e-17 89 24 21 516 1 glpK Glycerol kinase Rhizobium meliloti (strain 1021)
Q21S75 2.05e-17 88 26 17 497 3 glpK Glycerol kinase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2RST6 2.6e-17 88 26 16 466 3 glpK Glycerol kinase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9KRP4 2.67e-17 88 24 18 509 3 glpK Glycerol kinase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A1WKB4 3.2e-17 88 26 19 514 3 glpK Glycerol kinase Verminephrobacter eiseniae (strain EF01-2)
Q828K5 3.57e-17 87 24 19 521 3 glpK1 Glycerol kinase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B5ET10 5.37e-17 87 24 20 513 3 glpK Glycerol kinase Aliivibrio fischeri (strain MJ11)
C3MG71 6.14e-17 87 23 17 511 3 glpK Glycerol kinase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B6ER09 8.31e-17 86 24 21 514 3 glpK Glycerol kinase Aliivibrio salmonicida (strain LFI1238)
Q3J317 1.4e-16 85 24 18 509 3 glpK Glycerol kinase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9X049 1.42e-16 85 21 15 505 3 glpK1 Glycerol kinase 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q0AEC9 1.52e-16 85 24 19 497 3 glpK Glycerol kinase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8U940 1.87e-16 85 24 18 494 3 glpK Glycerol kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
B9J7X6 2.04e-16 85 25 16 475 3 glpK Glycerol kinase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1ZGW7 2.15e-16 85 27 15 464 3 glpK Glycerol kinase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B2IE09 2.56e-16 85 24 15 486 3 glpK Glycerol kinase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q9HNS5 2.66e-16 85 25 14 502 3 glpK Glycerol kinase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6S2 2.66e-16 85 25 14 502 3 glpK Glycerol kinase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q165D5 3.26e-16 84 24 17 493 3 glpK Glycerol kinase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A6WXV2 3.56e-16 84 26 16 508 3 glpK Glycerol kinase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B0TWZ7 4.33e-16 84 23 21 520 3 glpK Glycerol kinase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A3PJB4 4.54e-16 84 24 18 512 3 glpK Glycerol kinase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B2FI02 7.25e-16 84 24 15 519 3 glpK Glycerol kinase Stenotrophomonas maltophilia (strain K279a)
Q21944 8.52e-16 83 24 19 469 3 R11F4.1 Probable glycerol kinase Caenorhabditis elegans
Q15Q03 1.72e-15 82 25 21 490 3 glpK Glycerol kinase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B7KN92 1.83e-15 82 27 17 466 3 glpK Glycerol kinase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q0BKK9 2.17e-15 82 22 19 505 3 glpK Glycerol kinase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1W9 2.17e-15 82 22 19 505 3 glpK Glycerol kinase Francisella tularensis subsp. holarctica (strain LVS)
A7NE12 2.17e-15 82 22 19 505 3 glpK Glycerol kinase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9W8T7 2.49e-15 82 27 17 466 3 glpK Glycerol kinase Methylorubrum extorquens (strain PA1)
D4GYI5 2.61e-15 82 24 15 509 2 glpK Glycerol kinase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
B1MFT1 2.73e-15 82 25 16 508 3 glpK Glycerol kinase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B4SJT3 2.88e-15 82 24 17 519 3 glpK Glycerol kinase Stenotrophomonas maltophilia (strain R551-3)
Q9CB81 4.27e-15 81 24 14 530 3 glpK Glycerol kinase Mycobacterium leprae (strain TN)
A4IW85 4.49e-15 81 22 19 510 3 glpK Glycerol kinase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q6FDN3 4.71e-15 81 25 22 513 3 glpK Glycerol kinase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B8IKN3 4.74e-15 81 24 22 518 3 glpK Glycerol kinase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q5NIE5 4.95e-15 81 22 19 510 3 glpK Glycerol kinase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JU8 4.95e-15 81 22 19 510 3 glpK Glycerol kinase Francisella tularensis subsp. tularensis (strain FSC 198)
A0Q880 5.72e-15 80 22 19 510 3 glpK Glycerol kinase Francisella tularensis subsp. novicida (strain U112)
Q5ZMJ4 5.77e-15 81 21 18 535 2 GK5 Glycerol kinase 5 Gallus gallus
A4WRT7 7.7e-15 80 23 17 474 3 glpK Glycerol kinase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B2SF32 8.67e-15 80 22 19 510 3 glpK Glycerol kinase Francisella tularensis subsp. mediasiatica (strain FSC147)
P09099 1.6e-14 79 24 8 375 1 xylB Xylulose kinase Escherichia coli (strain K12)
A5VE44 1.65e-14 79 27 20 488 3 glpK Glycerol kinase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q9M8L4 1.82e-14 79 24 21 549 1 GLPK Glycerol kinase Arabidopsis thaliana
A9BRV2 2.78e-14 79 24 18 522 3 glpK Glycerol kinase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q6MJQ2 2.81e-14 79 23 18 501 3 glpK Glycerol kinase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A1TJR8 3.82e-14 78 24 16 486 3 glpK Glycerol kinase Paracidovorax citrulli (strain AAC00-1)
Q9RJM2 4e-14 78 24 13 460 3 glpK1 Glycerol kinase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A5G146 5.47e-14 77 25 20 528 3 glpK Glycerol kinase Acidiphilium cryptum (strain JF-5)
Q826J2 6.65e-14 77 24 14 515 3 glpK3 Glycerol kinase 3 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B4S2H6 7.29e-14 77 22 16 483 3 glpK Glycerol kinase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A5ES06 7.35e-14 77 23 19 510 3 glpK Glycerol kinase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q6ZS86 8.23e-14 77 20 15 528 1 GK5 Glycerol kinase 5 Homo sapiens
A9KQC2 8.68e-14 77 22 18 484 3 glpK Glycerol kinase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
O66746 1.42e-13 76 21 17 503 3 glpK Glycerol kinase Aquifex aeolicus (strain VF5)
Q89UK6 1.48e-13 76 22 19 526 3 glpK Glycerol kinase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q133H2 1.49e-13 76 24 19 488 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain BisB5)
B9JZR4 1.57e-13 76 24 20 500 3 glpK Glycerol kinase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B0SPA9 2.19e-13 76 22 13 475 3 glpK Glycerol kinase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SG67 2.19e-13 76 22 13 475 3 glpK Glycerol kinase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A4YLX6 3.91e-13 75 23 18 510 3 glpK Glycerol kinase Bradyrhizobium sp. (strain ORS 278)
Q63060 8.8e-13 74 22 15 465 2 Gk Glycerol kinase Rattus norvegicus
A4T5Y1 1.01e-12 73 25 14 526 3 glpK Glycerol kinase Mycolicibacterium gilvum (strain PYR-GCK)
Q64516 1.33e-12 73 22 15 465 1 Gk Glycerol kinase Mus musculus
A8I8V7 1.46e-12 73 27 19 485 3 glpK Glycerol kinase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q07K31 1.79e-12 73 23 18 488 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain BisA53)
Q14409 3.14e-12 72 24 18 471 1 GK3 Glycerol kinase 3 Homo sapiens
Q6GP95 3.6e-12 72 22 15 488 2 gk5 Glycerol kinase 5 Xenopus laevis
P32189 5.51e-12 72 23 15 469 1 GK Glycerol kinase Homo sapiens
P27156 1.11e-11 70 25 12 443 3 xylB Xylulose kinase Streptomyces rubiginosus
Q08D86 1.48e-11 70 22 19 547 2 GK5 Glycerol kinase 5 Bos taurus
A0JPE9 1.96e-11 70 22 19 547 2 gk5 Glycerol kinase 5 Danio rerio
A1TGD7 2.2e-11 69 24 14 526 3 glpK Glycerol kinase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9RK00 2.27e-11 69 25 16 449 3 xylB Xylulose kinase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q838L3 2.65e-11 69 23 19 462 3 rhaB Rhamnulokinase Enterococcus faecalis (strain ATCC 700802 / V583)
Q2YIQ1 3.66e-11 69 26 20 469 1 eryA Erythritol kinase Brucella abortus (strain 2308)
Q8NLP9 7.34e-11 68 21 18 514 3 glpK Glycerol kinase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QHT1 7.34e-11 68 21 18 514 3 glpK Glycerol kinase Corynebacterium glutamicum (strain R)
Q0IID9 7.76e-11 68 22 15 469 2 GK Glycerol kinase Bos taurus
Q6DCD1 8.57e-11 68 21 19 571 2 fggy FGGY carbohydrate kinase domain-containing protein Xenopus laevis
Q1QR91 3.52e-10 65 22 19 516 3 glpK Glycerol kinase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A2AJL3 4.26e-10 65 23 20 559 1 Fggy FGGY carbohydrate kinase domain-containing protein Mus musculus
Q8ESX1 6.61e-10 65 23 4 228 3 rhaB Rhamnulokinase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P29444 1.38e-09 63 22 16 506 3 xylB Xylulose kinase Klebsiella pneumoniae
Q9KCM0 2.39e-09 63 23 6 237 3 rhaB Rhamnulokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q54VT8 2.78e-09 63 20 18 569 3 gk Probable glycerol kinase Dictyostelium discoideum
Q2IZ89 4.57e-09 62 24 18 488 3 glpK Glycerol kinase Rhodopseudomonas palustris (strain HaA2)
C4LGQ3 7.73e-09 61 23 17 491 3 glpK Glycerol kinase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q96C11 1.13e-08 61 22 21 564 1 FGGY FGGY carbohydrate kinase domain-containing protein Homo sapiens
Q49V87 2.49e-08 60 22 14 392 3 araB2 Ribulokinase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A7IJ56 5.53e-08 58 23 21 503 3 glpK Glycerol kinase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04570
Feature type CDS
Gene lsrK
Product autoinducer-2 kinase
Location 966411 - 968003 (strand: 1)
Length 1593 (nucleotides) / 530 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_48
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF00370 FGGY family of carbohydrate kinases, N-terminal domain
PF02782 FGGY family of carbohydrate kinases, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1070 Carbohydrate transport and metabolism (G) G Sugar (pentulose or hexulose) kinase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11216 autoinducer-2 kinase [EC:2.7.1.189] Quorum sensing -

Protein Sequence

MDQSTGSQSSKYLMALDAGTGSIRAVIFDLHGNQIAAGQAEWRHNELPDVPGSMEFDLHTNWQLACHCIKLALKNAGLPASAIAGVSACSMREGIVLYDRSGEPIWACANVDARSSREVSELKELYNNTFEYDVYQCSGQTLALGAMPRLLWLAHHRPDIYRQAGTLTMISDWLACKLSGELAVDPSNAGTTGMLDLVTRDWRPGLLEMAGLRADILSPVKETGTVLGYITAKAAEESGLAKGTPVVMGGGDVQLGCLGLGVVKPGQTAVLGGTFWQQVVNLPQPVTDPDMNTRINPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLVAERLGVDAYSLLEDMAARVPAGSHGIMPIFSDVMRFKSWYHAAPSFINLSIDAEKSNKASLFRALEENAAIVSSLNLDLIARFSGVKADSLVFAGGGSKGKLWSQILADVTGVPVRVPVVKEATALGCAIAAGTGVGLYDDMASAGERLVQWQQEYQPNPEHRDVYDKAKQNWQKVYADQLTLVDSGLTTSMWKAPGLK

Flanking regions ( +/- flanking 50bp)

ATTTCATGATGTACCGGTATCAATCCAATTAATTTTGTGAGGATGGCGACATGGATCAGAGCACAGGCAGCCAGTCATCAAAGTACCTGATGGCACTGGATGCGGGAACAGGCAGTATCAGAGCCGTAATTTTTGATCTTCACGGCAACCAGATTGCCGCCGGACAGGCGGAGTGGCGTCACAATGAACTGCCGGATGTTCCGGGCTCAATGGAATTTGACCTGCACACCAACTGGCAGCTGGCATGTCACTGCATTAAACTGGCACTGAAAAACGCCGGATTACCGGCCTCCGCGATTGCGGGTGTGTCTGCCTGCTCTATGCGTGAGGGCATTGTTCTCTATGATCGCAGCGGGGAGCCTATCTGGGCATGTGCCAATGTGGATGCCCGCTCAAGCCGCGAAGTCAGCGAATTAAAAGAGCTGTACAACAATACCTTTGAATATGATGTTTATCAGTGCTCCGGGCAGACCCTGGCGCTGGGTGCAATGCCGCGCTTGTTATGGCTGGCACATCACCGCCCGGATATCTACCGGCAGGCGGGAACACTGACGATGATCAGCGACTGGCTCGCCTGCAAACTGAGCGGCGAACTGGCAGTCGATCCTTCCAATGCAGGAACTACCGGTATGCTCGATTTAGTCACCCGCGACTGGCGTCCGGGTCTGCTGGAAATGGCGGGATTGCGGGCAGATATTCTCTCGCCGGTAAAAGAAACCGGTACGGTACTGGGATATATTACGGCGAAAGCCGCTGAAGAATCCGGGCTGGCAAAAGGTACGCCGGTTGTTATGGGCGGCGGGGATGTTCAGCTTGGCTGCCTGGGCCTCGGCGTTGTTAAACCGGGACAAACAGCGGTGCTCGGCGGAACGTTCTGGCAGCAGGTGGTTAACCTGCCGCAGCCGGTCACTGATCCTGACATGAATACCCGTATTAACCCGCATGTTATCCCGGGCATGGTTCAGGCGGAATCGATCAGTTTCTTTACCGGGCTTACCATGCGTTGGTTCCGTGATGCGTTCTGCGCGGAAGAAAAACTGGTCGCCGAACGGCTTGGTGTGGATGCCTATTCATTGCTGGAAGATATGGCAGCCCGCGTTCCGGCAGGCTCTCACGGTATCATGCCGATTTTTTCTGATGTGATGCGCTTTAAATCCTGGTATCACGCCGCACCCTCTTTTATCAATCTGTCGATTGATGCAGAAAAGAGTAACAAAGCGTCTCTGTTCCGCGCACTGGAAGAGAACGCCGCGATTGTTTCCTCACTGAATCTGGATTTAATTGCCCGGTTCAGCGGCGTGAAAGCTGATTCTCTGGTATTTGCAGGCGGAGGCTCGAAAGGCAAGCTCTGGAGCCAGATTCTGGCCGATGTTACCGGTGTGCCGGTTCGTGTGCCGGTTGTGAAAGAAGCAACGGCACTGGGCTGTGCGATTGCCGCCGGTACAGGTGTCGGGTTATATGATGATATGGCGTCCGCCGGGGAGCGCCTGGTGCAATGGCAGCAGGAATACCAGCCAAATCCGGAACATCGCGACGTCTATGACAAAGCGAAACAAAACTGGCAAAAAGTCTATGCGGATCAACTGACGCTGGTGGACTCCGGTCTGACCACATCAATGTGGAAGGCGCCGGGACTTAAATAATCCCTGTATCAATAAAAAACAGAGATACCGGATGTCCGGGTAAACCTGCG