Homologs in group_543

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01270 FBDBKF_01270 85.5 Morganella morganii S1 trpS tryptophan--tRNA ligase
EHELCC_00275 EHELCC_00275 85.5 Morganella morganii S2 trpS tryptophan--tRNA ligase
NLDBIP_03185 NLDBIP_03185 85.5 Morganella morganii S4 trpS tryptophan--tRNA ligase
LHKJJB_04700 LHKJJB_04700 85.5 Morganella morganii S3 trpS tryptophan--tRNA ligase
HKOGLL_02345 HKOGLL_02345 85.5 Morganella morganii S5 trpS tryptophan--tRNA ligase
PMI_RS08460 PMI_RS08460 69.4 Proteus mirabilis HI4320 trpS tryptophan--tRNA ligase

Distribution of the homologs in the orthogroup group_543

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_543

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q46127 4.66e-130 377 56 2 330 3 trpS Tryptophan--tRNA ligase Clostridium longisporum
Q9RVD6 5.4e-124 362 56 1 326 1 trpS2 Tryptophan--tRNA ligase 2 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9CJD1 1.08e-123 361 54 3 336 3 trpS Tryptophan--tRNA ligase Lactococcus lactis subsp. lactis (strain IL1403)
P0DG61 8.5e-119 349 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain SSI-1)
P67598 8.5e-119 349 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9A2 8.5e-119 349 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG60 8.5e-119 349 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99XH4 9.79e-119 348 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M1
P67596 1.15e-118 348 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67595 1.15e-118 348 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DWP7 2.15e-117 345 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2J5 2.15e-117 345 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype III (strain NEM316)
Q8DRR1 1.38e-116 343 52 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
O83640 6.28e-82 255 43 4 329 3 trpS Tryptophan--tRNA ligase Treponema pallidum (strain Nichols)
Q9WYW2 5.13e-74 234 42 5 331 1 trpS Tryptophan--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9Z7A4 3.21e-72 230 38 4 330 3 trpS Tryptophan--tRNA ligase Chlamydia pneumoniae
Q821H9 4.78e-69 222 38 4 330 3 trpS Tryptophan--tRNA ligase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9PJF5 1.38e-68 221 37 5 334 3 trpS Tryptophan--tRNA ligase Chlamydia muridarum (strain MoPn / Nigg)
O84589 2.45e-68 220 37 4 330 1 trpS Tryptophan--tRNA ligase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O51038 4.84e-66 214 38 4 333 3 trpS Tryptophan--tRNA ligase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9RWV7 3.2e-51 176 32 4 328 3 trpS Tryptophan--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8RGA3 5.33e-48 167 34 8 333 3 trpS Tryptophan--tRNA ligase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8DHG3 2.8e-42 152 35 10 335 3 trpS Tryptophan--tRNA ligase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7MT94 5.55e-40 146 32 9 330 3 trpS Tryptophan--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q5HW79 5.81e-40 145 30 7 326 3 trpS Tryptophan--tRNA ligase Campylobacter jejuni (strain RM1221)
Q9PIB4 5.81e-40 145 30 7 326 1 trpS Tryptophan--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
O67115 1.42e-38 144 40 2 214 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
O67115 1.94e-16 82 39 0 107 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
Q8YXE4 2.99e-37 139 34 10 333 3 trpS Tryptophan--tRNA ligase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q7UQA4 1.06e-36 137 30 5 325 3 trpS Tryptophan--tRNA ligase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9AC05 2.83e-36 137 32 8 337 3 trpS Tryptophan--tRNA ligase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7NCG8 5.92e-36 135 32 8 343 3 trpS Tryptophan--tRNA ligase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q4UL98 5.33e-35 133 32 12 335 3 trpS Tryptophan--tRNA ligase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92HR1 8e-35 132 31 12 335 3 trpS Tryptophan--tRNA ligase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q7TV34 8.69e-35 132 32 12 348 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain MIT 9313)
Q68WR2 1.08e-34 132 31 11 334 3 trpS Tryptophan--tRNA ligase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZD76 6.54e-34 130 30 11 334 3 trpS Tryptophan--tRNA ligase Rickettsia prowazekii (strain Madrid E)
P73655 7.77e-34 130 33 10 339 3 trpS Tryptophan--tRNA ligase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Y0A1 5.11e-33 129 34 4 243 3 trpS Tryptophan--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y0A1 1.82e-14 77 32 2 146 3 trpS Tryptophan--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87B10 8.16e-32 126 31 9 321 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q1RIE3 1.49e-31 124 32 10 334 3 trpS Tryptophan--tRNA ligase Rickettsia bellii (strain RML369-C)
Q9PG74 2.76e-31 125 32 9 302 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain 9a5c)
P00953 1.04e-30 121 29 9 334 1 trpS Tryptophan--tRNA ligase Geobacillus stearothermophilus
Q8PFH5 2.88e-30 122 30 9 322 3 trpS Tryptophan--tRNA ligase Xanthomonas axonopodis pv. citri (strain 306)
Q7TTU9 4.48e-30 120 32 12 342 3 trpS Tryptophan--tRNA ligase Parasynechococcus marenigrum (strain WH8102)
Q92SI9 5.15e-30 120 29 10 362 3 trpS Tryptophan--tRNA ligase Rhizobium meliloti (strain 1021)
P43835 7.93e-30 119 28 10 338 1 trpS Tryptophan--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7W5T6 1.6e-29 120 29 9 340 3 trpS Tryptophan--tRNA ligase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGI7 1.6e-29 120 29 9 340 3 trpS Tryptophan--tRNA ligase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ05 2e-29 120 29 9 343 3 trpS Tryptophan--tRNA ligase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8ZJF2 2.31e-29 118 29 9 348 1 trpS Tryptophan--tRNA ligase Yersinia pestis
Q8NSJ4 3.24e-29 118 29 7 337 3 trpS Tryptophan--tRNA ligase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q98C31 4.25e-29 117 28 7 353 3 trpS Tryptophan--tRNA ligase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q891C7 4.4e-29 117 28 12 338 3 trpS Tryptophan--tRNA ligase Clostridium tetani (strain Massachusetts / E88)
Q9KNV7 6.62e-29 117 29 9 347 1 trpS Tryptophan--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8P3Z4 1.1e-28 118 29 10 339 3 trpS Tryptophan--tRNA ligase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9CYK1 1.19e-28 116 28 7 340 1 Wars2 Tryptophan--tRNA ligase, mitochondrial Mus musculus
Q8EK12 1.19e-28 116 27 8 343 3 trpS Tryptophan--tRNA ligase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9JTQ0 1.27e-28 116 28 10 336 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P57956 1.47e-28 115 28 7 339 3 trpS Tryptophan--tRNA ligase Pasteurella multocida (strain Pm70)
Q7VBM9 1.48e-28 116 29 8 337 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P67587 1.49e-28 116 28 10 363 3 trpS Tryptophan--tRNA ligase Brucella suis biovar 1 (strain 1330)
P67586 1.49e-28 116 28 10 363 3 trpS Tryptophan--tRNA ligase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9JYQ9 2.51e-28 115 27 8 334 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7VPB2 3.03e-28 115 28 7 344 3 trpS Tryptophan--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9EYY6 5.44e-28 114 28 7 339 3 trpS Tryptophan--tRNA ligase Klebsiella aerogenes
Q5E2G5 6.79e-28 114 28 11 352 3 trpS Tryptophan--tRNA ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q89W91 7.13e-28 114 28 10 353 3 trpS Tryptophan--tRNA ligase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P67588 7.16e-28 114 28 7 339 3 trpS Tryptophan--tRNA ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67589 7.16e-28 114 28 7 339 3 trpS Tryptophan--tRNA ligase Escherichia coli O157:H7
P00954 7.54e-28 114 28 7 339 1 trpS Tryptophan--tRNA ligase Escherichia coli (strain K12)
P0A2P2 1.09e-27 113 28 7 339 3 trpS Tryptophan--tRNA ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P3 1.09e-27 113 28 7 339 3 trpS Tryptophan--tRNA ligase Salmonella typhi
Q83JA5 1.54e-27 113 28 7 339 3 trpS Tryptophan--tRNA ligase Shigella flexneri
Q8FRR3 4.94e-27 112 29 8 341 3 trpS Tryptophan--tRNA ligase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q81TS6 5.58e-27 111 27 8 333 3 trpS Tryptophan--tRNA ligase Bacillus anthracis
Q8XMQ5 6.25e-27 111 28 9 340 3 trpS Tryptophan--tRNA ligase Clostridium perfringens (strain 13 / Type A)
Q9K8Y2 7.78e-27 111 28 11 335 3 trpS Tryptophan--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9UGM6 8.41e-27 111 28 8 333 1 WARS2 Tryptophan--tRNA ligase, mitochondrial Homo sapiens
Q7V286 9.18e-27 111 28 10 340 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q97LD6 1.34e-26 110 27 10 347 3 trpS Tryptophan--tRNA ligase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8DCT6 1.38e-26 110 28 9 347 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain CMCP6)
Q3T099 1.39e-26 111 28 8 333 2 WARS2 Tryptophan--tRNA ligase, mitochondrial Bos taurus
Q87L13 2.31e-26 110 27 9 347 3 trpS Tryptophan--tRNA ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87WW4 2.83e-26 111 28 9 327 3 trpS Tryptophan--tRNA ligase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7MH15 3.33e-26 109 27 9 347 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain YJ016)
Q830U2 6.81e-26 108 28 11 338 3 trpS Tryptophan--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
Q6AGQ7 7.36e-26 108 27 7 324 3 trpS Tryptophan--tRNA ligase Leifsonia xyli subsp. xyli (strain CTCB07)
Q8R9X8 1.1e-25 108 27 10 337 3 trpS Tryptophan--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P59466 1.24e-25 108 26 7 338 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P21656 1.74e-25 107 27 10 334 1 trpS Tryptophan--tRNA ligase Bacillus subtilis (strain 168)
Q49901 3.75e-25 107 28 8 325 3 trpS Tryptophan--tRNA ligase Mycobacterium leprae (strain TN)
Q88NA1 5.04e-25 108 29 9 325 3 trpS Tryptophan--tRNA ligase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P67594 5.52e-25 106 27 10 333 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GAT0 5.52e-25 106 27 10 333 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MSSA476)
P67593 5.52e-25 106 27 10 333 1 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain N315)
P67592 5.52e-25 106 27 10 333 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH88 5.52e-25 106 27 10 333 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain COL)
Q7NA61 5.78e-25 106 27 9 342 3 trpS Tryptophan--tRNA ligase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9PQW8 6.64e-25 106 27 9 339 3 trpS Tryptophan--tRNA ligase Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q9KZA7 8.22e-25 105 27 8 344 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WFT3 1.26e-24 105 28 8 330 1 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFT2 1.26e-24 105 28 8 330 3 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67591 1.26e-24 105 28 8 330 3 trpS Tryptophan--tRNA ligase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7VIP6 1.85e-24 104 26 9 335 3 trpS Tryptophan--tRNA ligase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6GI89 2.01e-24 104 27 10 333 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MRSA252)
Q7MAE0 2.78e-24 104 26 7 330 3 trpS Tryptophan--tRNA ligase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8CT69 3.32e-24 103 27 11 337 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQH4 3.67e-24 103 27 13 337 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q83HC3 4.78e-24 103 26 11 341 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain TW08/27)
Q8D1X5 5.81e-24 103 25 7 336 3 trpS Tryptophan--tRNA ligase Wigglesworthia glossinidia brevipalpis
C0HKD6 6.05e-24 103 26 11 344 2 wars-2 Tryptophan--tRNA ligase, mitochondrial Caenorhabditis elegans
Q82HU1 6.39e-24 103 29 8 337 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8UIE8 9.85e-24 103 28 11 364 3 trpS Tryptophan--tRNA ligase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8Y577 2.77e-23 101 28 11 338 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9HVX6 3.16e-23 103 28 9 338 3 trpS Tryptophan--tRNA ligase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q83FN1 3.21e-23 101 26 11 341 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain Twist)
Q71XG7 1.91e-22 99 28 11 338 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
P56396 2.72e-22 98 29 16 344 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
Q98PH7 3.59e-22 98 34 2 167 3 trpS Tryptophan--tRNA ligase Mycoplasmopsis pulmonis (strain UAB CTIP)
P57602 4.7e-22 98 24 10 350 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8RXE9 5.51e-22 99 26 8 351 1 OVA4 Tryptophan--tRNA ligase, chloroplastic/mitochondrial Arabidopsis thaliana
Q9ZJX4 1.77e-21 96 28 13 340 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
P04803 2.61e-21 96 27 10 366 1 MSW1 Tryptophan--tRNA ligase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q929H5 7.61e-21 94 28 11 338 3 trpS Tryptophan--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q82E91 9.84e-21 94 28 9 336 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8ERU2 2.66e-20 93 26 10 331 3 trpS Tryptophan--tRNA ligase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8CJX0 5.19e-20 92 28 7 332 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P75510 9.54e-20 92 25 9 340 1 trpS Tryptophan--tRNA ligase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q7VRN5 2.82e-19 90 26 11 347 3 trpS Tryptophan--tRNA ligase Blochmanniella floridana
Q8K941 9.07e-19 89 25 9 335 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q7NAT8 2.12e-18 88 30 2 171 3 trpS Tryptophan--tRNA ligase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q86A90 2.23e-17 85 28 9 301 3 wars2 Tryptophan--tRNA ligase, mitochondrial Dictyostelium discoideum
O42875 2.51e-17 85 25 9 351 3 msw1 Tryptophan--tRNA ligase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P47372 2.68e-17 85 26 10 340 3 trpS Tryptophan--tRNA ligase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8EVV1 4.81e-17 84 23 10 338 3 trpS Tryptophan--tRNA ligase Malacoplasma penetrans (strain HF-2)
Q9HN66 4.55e-15 79 27 10 305 3 trpS2 Tryptophan--tRNA ligase 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O27795 1.28e-10 65 23 9 312 3 tyrS Tyrosine--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A5UKJ0 6.91e-10 62 24 11 320 3 tyrS Tyrosine--tRNA ligase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q2FNA1 4.91e-08 57 23 10 305 3 tyrS Tyrosine--tRNA ligase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q5JEP3 8.39e-08 57 23 12 298 3 trpS Tryptophan--tRNA ligase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
C6A032 1.92e-07 55 23 12 305 3 trpS Tryptophan--tRNA ligase Thermococcus sibiricus (strain DSM 12597 / MM 739)
Q5V4J1 3.99e-07 54 23 12 333 3 tyrS Tyrosine--tRNA ligase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B6YUH1 4.94e-07 54 23 14 333 3 trpS Tryptophan--tRNA ligase Thermococcus onnurineus (strain NA1)
O29482 6.15e-07 53 26 9 230 1 tyrS Tyrosine--tRNA ligase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8U453 3.26e-06 52 24 13 300 3 trpS Tryptophan--tRNA ligase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B7XHC1 5.74e-06 51 20 8 302 3 EBI_24879 Probable tyrosine--tRNA ligase, cytoplasmic Enterocytozoon bieneusi (strain H348)
Q8ZTU5 8.78e-06 50 24 13 323 3 trpS Tryptophan--tRNA ligase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q5P7U2 1.15e-05 50 25 9 216 3 tyrS Tyrosine--tRNA ligase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9HN62 1.57e-05 49 27 8 245 3 tyrS Tyrosine--tRNA ligase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7E0 1.57e-05 49 27 8 245 3 tyrS Tyrosine--tRNA ligase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q7VN81 1.7e-05 49 27 13 279 3 tyrS Tyrosine--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8PVK0 1.8e-05 49 25 10 232 3 tyrS Tyrosine--tRNA ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A3MX72 2.56e-05 49 20 9 303 3 trpS Tryptophan--tRNA ligase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
A6URQ1 2.6e-05 48 23 15 319 3 tyrS Tyrosine--tRNA ligase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A4WL99 2.68e-05 49 23 15 321 3 trpS Tryptophan--tRNA ligase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
A3CYG9 3.13e-05 48 24 6 223 3 tyrS Tyrosine--tRNA ligase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8TXZ2 7.18e-05 47 24 10 225 3 tyrS Tyrosine--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q6M0K7 7.87e-05 47 21 13 321 3 tyrS Tyrosine--tRNA ligase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q65T71 9.73e-05 47 26 13 280 3 tyrS Tyrosine--tRNA ligase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q6AJ82 0.000133 47 25 15 284 3 tyrS Tyrosine--tRNA ligase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q46BQ5 0.000137 46 22 10 313 3 tyrS Tyrosine--tRNA ligase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q2KV13 0.00022 46 28 8 220 3 tyrS Tyrosine--tRNA ligase Bordetella avium (strain 197N)
P43836 0.000248 46 27 9 222 3 tyrS Tyrosine--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CMQ8 0.000266 46 25 14 283 3 tyrS Tyrosine--tRNA ligase Pasteurella multocida (strain Pm70)
Q2NHE1 0.000352 45 21 5 212 3 tyrS Tyrosine--tRNA ligase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q4QL45 0.00036 45 27 9 222 3 tyrS Tyrosine--tRNA ligase Haemophilus influenzae (strain 86-028NP)
Q8TSI1 0.000367 45 24 10 229 3 tyrS Tyrosine--tRNA ligase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07310
Feature type CDS
Gene trpS
Product tryptophan--tRNA ligase
Location 1524429 - 1525442 (strand: -1)
Length 1014 (nucleotides) / 337 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_543
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00579 tRNA synthetases class I (W and Y)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0180 Translation, ribosomal structure and biogenesis (J) J Tryptophanyl-tRNA synthetase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] Aminoacyl-tRNA biosynthesis -

Protein Sequence

MPAHQTNPIILTGDRITGPLHLGHYIGSLQQRVLLQHSSTQYVLMADLQGLTDNGSHPEKVNRYLYDVVADYLAVGIDPGRSVICLQSALPALAELTLLYLNLVTVSRLERNPTVKHEIIQKQFTRTVPAGFLIYPVSQAADISAFKAELVPVGEDQLPMIEQTNEIVSKVNSITGEPLLVHCRAQVGKAGRLPGIDGNGKMSKSLGNVINLSVSEDELTRAVNAMFTDPQHLRVSDPGRIEGNVVFTYLDAFHPDTALISEMKAQYQAGGLGDRQCKTVLNDCLQSLLAPVREERVRLMADKPYLLSVIRSGTEKAREVTQQTLDQVKRGMGLFVI

Flanking regions ( +/- flanking 50bp)

GTTGGCTGCATCCTGAATGACGTTGGGTATAGTATTCAAGAGGAAATAGTATGCCAGCTCATCAAACCAACCCGATTATCCTGACCGGCGACCGTATTACCGGGCCATTGCATCTTGGTCATTATATCGGCTCCCTGCAACAGCGCGTTTTACTGCAACATTCGTCCACTCAATATGTGTTGATGGCAGACTTACAGGGTCTGACTGATAATGGCTCACATCCGGAAAAAGTTAATCGCTATCTGTATGATGTGGTTGCTGATTATCTGGCGGTTGGTATCGACCCCGGGCGCTCTGTGATTTGCCTGCAATCCGCACTGCCTGCGCTGGCGGAACTGACACTGCTGTATCTCAATCTGGTCACTGTTTCCCGCCTTGAGCGCAATCCGACAGTCAAACATGAAATCATTCAAAAGCAATTTACCCGCACCGTTCCGGCAGGTTTTCTTATCTATCCGGTAAGCCAGGCGGCAGATATTTCGGCGTTCAAAGCAGAGCTGGTGCCTGTCGGGGAAGACCAGTTGCCGATGATTGAGCAAACCAATGAAATCGTCAGTAAAGTAAACAGTATTACCGGCGAACCGCTGCTGGTGCATTGCCGTGCGCAGGTTGGTAAAGCAGGGCGGTTGCCCGGCATTGACGGCAACGGGAAAATGTCAAAATCCCTCGGAAATGTGATCAATCTTTCGGTCAGTGAGGATGAGTTAACCCGCGCGGTGAATGCGATGTTTACTGACCCGCAGCACTTGCGGGTATCTGATCCCGGGCGGATTGAGGGCAATGTCGTGTTTACGTATCTTGATGCGTTTCATCCGGATACCGCCCTGATTTCTGAGATGAAAGCGCAGTATCAGGCAGGTGGGCTGGGTGACCGGCAGTGTAAAACGGTATTGAATGACTGTTTGCAATCATTGTTGGCACCGGTGAGAGAAGAGCGGGTGCGTCTGATGGCGGATAAACCCTATCTGCTTTCCGTTATCCGCAGCGGCACGGAAAAGGCGCGGGAAGTAACACAACAAACGTTGGATCAGGTAAAGCGGGGCATGGGGCTGTTTGTCATTTGATTGACGGATCATGCGGTTTTAACCGGATGCGATTGATTCCCGTTTCCGGG