Homologs in group_620

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01270 FBDBKF_01270 70.0 Morganella morganii S1 trpS tryptophan--tRNA ligase
EHELCC_00275 EHELCC_00275 70.0 Morganella morganii S2 trpS tryptophan--tRNA ligase
NLDBIP_03185 NLDBIP_03185 70.0 Morganella morganii S4 trpS tryptophan--tRNA ligase
LHKJJB_04700 LHKJJB_04700 70.0 Morganella morganii S3 trpS tryptophan--tRNA ligase
HKOGLL_02345 HKOGLL_02345 70.0 Morganella morganii S5 trpS tryptophan--tRNA ligase
F4V73_RS07310 F4V73_RS07310 69.4 Morganella psychrotolerans trpS tryptophan--tRNA ligase

Distribution of the homologs in the orthogroup group_620

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_620

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q46127 7.55e-139 400 58 2 332 3 trpS Tryptophan--tRNA ligase Clostridium longisporum
P0DG61 2.08e-120 353 52 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain SSI-1)
P67598 2.08e-120 353 52 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9A2 2.08e-120 353 52 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG60 2.08e-120 353 52 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8DWP7 3.71e-120 352 53 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2J5 3.71e-120 352 53 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype III (strain NEM316)
Q99XH4 5.78e-119 349 52 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M1
Q9CJD1 9.66e-119 349 52 3 335 3 trpS Tryptophan--tRNA ligase Lactococcus lactis subsp. lactis (strain IL1403)
Q9RVD6 5.05e-118 347 52 1 326 1 trpS2 Tryptophan--tRNA ligase 2 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P67596 3.59e-115 340 51 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67595 3.59e-115 340 51 3 335 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DRR1 1.5e-114 338 51 3 336 3 trpS Tryptophan--tRNA ligase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
O83640 3.19e-78 245 40 3 327 3 trpS Tryptophan--tRNA ligase Treponema pallidum (strain Nichols)
O84589 1.46e-71 229 36 4 333 1 trpS Tryptophan--tRNA ligase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9Z7A4 3.87e-71 228 37 5 341 3 trpS Tryptophan--tRNA ligase Chlamydia pneumoniae
Q9PJF5 7.27e-71 227 36 5 336 3 trpS Tryptophan--tRNA ligase Chlamydia muridarum (strain MoPn / Nigg)
Q821H9 3.82e-68 220 37 6 343 3 trpS Tryptophan--tRNA ligase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
O51038 4.12e-67 217 37 4 335 3 trpS Tryptophan--tRNA ligase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9WYW2 5.45e-66 214 37 5 331 1 trpS Tryptophan--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9RWV7 3.18e-51 176 32 4 333 3 trpS Tryptophan--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8RGA3 1.74e-49 171 34 10 335 3 trpS Tryptophan--tRNA ligase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5HW79 1.41e-44 158 31 6 325 3 trpS Tryptophan--tRNA ligase Campylobacter jejuni (strain RM1221)
Q9PIB4 1.41e-44 158 31 6 325 1 trpS Tryptophan--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q68WR2 4.02e-41 149 32 9 337 3 trpS Tryptophan--tRNA ligase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92HR1 1.13e-40 148 32 9 337 3 trpS Tryptophan--tRNA ligase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8DHG3 2.59e-40 147 31 8 337 3 trpS Tryptophan--tRNA ligase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9ZD76 6.52e-40 146 32 9 337 3 trpS Tryptophan--tRNA ligase Rickettsia prowazekii (strain Madrid E)
Q4UL98 8.75e-40 145 32 9 337 3 trpS Tryptophan--tRNA ligase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q7MT94 2.26e-39 144 32 12 340 3 trpS Tryptophan--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q7UQA4 5.93e-39 143 32 8 327 3 trpS Tryptophan--tRNA ligase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7TV34 7.21e-38 140 31 9 340 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain MIT 9313)
Q8YXE4 1.35e-37 140 32 8 335 3 trpS Tryptophan--tRNA ligase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O67115 6.85e-37 139 40 2 204 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
P73655 1.04e-36 137 33 9 340 3 trpS Tryptophan--tRNA ligase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7NCG8 1.11e-35 135 28 7 333 3 trpS Tryptophan--tRNA ligase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q1RIE3 1.15e-35 135 31 9 337 3 trpS Tryptophan--tRNA ligase Rickettsia bellii (strain RML369-C)
Q9AC05 2.16e-35 134 32 10 340 3 trpS Tryptophan--tRNA ligase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7V286 6.95e-35 133 30 11 340 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q81TS6 7.4e-35 132 30 9 333 3 trpS Tryptophan--tRNA ligase Bacillus anthracis
Q8PFH5 4.8e-34 132 29 10 344 3 trpS Tryptophan--tRNA ligase Xanthomonas axonopodis pv. citri (strain 306)
Q7VZ05 6.12e-34 132 30 11 339 3 trpS Tryptophan--tRNA ligase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q87B10 6.81e-34 132 30 8 319 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8Y0A1 7.34e-34 131 38 3 193 3 trpS Tryptophan--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y0A1 1.19e-15 80 31 4 157 3 trpS Tryptophan--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P00953 8.6e-34 130 31 10 334 1 trpS Tryptophan--tRNA ligase Geobacillus stearothermophilus
Q7W5T6 1.06e-33 132 30 11 336 3 trpS Tryptophan--tRNA ligase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGI7 1.06e-33 132 30 11 336 3 trpS Tryptophan--tRNA ligase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q891C7 1.08e-33 130 29 9 342 3 trpS Tryptophan--tRNA ligase Clostridium tetani (strain Massachusetts / E88)
Q9PG74 6.42e-33 129 30 8 319 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain 9a5c)
Q7TTU9 2.86e-32 126 30 10 336 3 trpS Tryptophan--tRNA ligase Parasynechococcus marenigrum (strain WH8102)
Q9K8Y2 3.36e-31 123 30 12 339 3 trpS Tryptophan--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8P3Z4 1.39e-30 123 29 9 319 3 trpS Tryptophan--tRNA ligase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q7VBM9 1.08e-29 119 30 12 341 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q88NA1 1.63e-29 120 30 9 328 3 trpS Tryptophan--tRNA ligase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8XMQ5 3.28e-29 117 28 8 341 3 trpS Tryptophan--tRNA ligase Clostridium perfringens (strain 13 / Type A)
Q830U2 3.68e-29 117 29 10 337 3 trpS Tryptophan--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
Q87WW4 1.33e-28 118 29 9 328 3 trpS Tryptophan--tRNA ligase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9JYQ9 1.39e-28 116 28 9 338 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P67594 2.38e-28 115 31 11 334 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GAT0 2.38e-28 115 31 11 334 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MSSA476)
P67593 2.38e-28 115 31 11 334 1 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain N315)
P67592 2.38e-28 115 31 11 334 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH88 2.38e-28 115 31 11 334 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain COL)
Q97LD6 2.71e-28 115 27 6 338 3 trpS Tryptophan--tRNA ligase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5HQH4 2.78e-28 115 30 11 335 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P21656 2.92e-28 115 27 10 340 1 trpS Tryptophan--tRNA ligase Bacillus subtilis (strain 168)
Q8FRR3 2.98e-28 115 28 9 345 3 trpS Tryptophan--tRNA ligase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8CT69 3.89e-28 114 29 10 335 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8ERU2 7.01e-28 114 28 10 333 3 trpS Tryptophan--tRNA ligase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P43835 8.42e-28 114 28 10 339 1 trpS Tryptophan--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6GI89 9.76e-28 114 31 11 334 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MRSA252)
Q6AGQ7 1.63e-27 113 26 7 324 3 trpS Tryptophan--tRNA ligase Leifsonia xyli subsp. xyli (strain CTCB07)
Q9JTQ0 3.34e-27 112 28 11 344 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P57956 4.92e-27 112 28 10 347 3 trpS Tryptophan--tRNA ligase Pasteurella multocida (strain Pm70)
Q7MAE0 4.95e-27 111 27 7 333 3 trpS Tryptophan--tRNA ligase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8NSJ4 5.88e-27 112 26 7 336 3 trpS Tryptophan--tRNA ligase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8R9X8 8.86e-27 111 27 8 334 3 trpS Tryptophan--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7VPB2 9.02e-27 111 27 8 345 3 trpS Tryptophan--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9KNV7 1.68e-26 110 28 8 342 1 trpS Tryptophan--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q92SI9 1.98e-26 110 27 9 365 3 trpS Tryptophan--tRNA ligase Rhizobium meliloti (strain 1021)
P67587 2.36e-26 110 29 8 357 3 trpS Tryptophan--tRNA ligase Brucella suis biovar 1 (strain 1330)
P67586 2.36e-26 110 29 8 357 3 trpS Tryptophan--tRNA ligase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9HVX6 3.09e-26 111 27 8 335 3 trpS Tryptophan--tRNA ligase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CYK1 3.25e-26 110 28 7 337 1 Wars2 Tryptophan--tRNA ligase, mitochondrial Mus musculus
Q8EK12 4.99e-26 109 27 10 342 3 trpS Tryptophan--tRNA ligase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8Y577 5.78e-26 108 28 10 340 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9EYY6 8.74e-26 108 27 7 338 3 trpS Tryptophan--tRNA ligase Klebsiella aerogenes
Q71XG7 2.58e-25 107 28 10 340 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
Q5E2G5 3.99e-25 106 28 12 347 3 trpS Tryptophan--tRNA ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P00954 4.02e-25 106 26 8 338 1 trpS Tryptophan--tRNA ligase Escherichia coli (strain K12)
P9WFT3 4.73e-25 106 27 9 330 1 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFT2 4.73e-25 106 27 9 330 3 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67591 4.73e-25 106 27 9 330 3 trpS Tryptophan--tRNA ligase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8ZJF2 6.94e-25 106 27 9 356 1 trpS Tryptophan--tRNA ligase Yersinia pestis
Q98C31 7.45e-25 106 28 8 361 3 trpS Tryptophan--tRNA ligase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q7VIP6 8.21e-25 105 26 9 337 3 trpS Tryptophan--tRNA ligase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q83JA5 8.47e-25 105 26 8 338 3 trpS Tryptophan--tRNA ligase Shigella flexneri
Q9UGM6 8.84e-25 106 28 9 342 1 WARS2 Tryptophan--tRNA ligase, mitochondrial Homo sapiens
Q83HC3 9.61e-25 105 28 11 341 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain TW08/27)
Q7NA61 1.04e-24 105 27 12 350 3 trpS Tryptophan--tRNA ligase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q98PH7 1.13e-24 105 27 10 340 3 trpS Tryptophan--tRNA ligase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q89W91 1.2e-24 105 26 9 349 3 trpS Tryptophan--tRNA ligase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P67588 1.23e-24 105 26 8 338 3 trpS Tryptophan--tRNA ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67589 1.23e-24 105 26 8 338 3 trpS Tryptophan--tRNA ligase Escherichia coli O157:H7
P57602 1.79e-24 105 27 9 341 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q87L13 3.2e-24 104 26 8 340 3 trpS Tryptophan--tRNA ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q83FN1 6.05e-24 103 28 11 341 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain Twist)
Q8CJX0 6.93e-24 103 26 5 332 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KZA7 1.17e-23 102 26 8 342 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A2P2 1.24e-23 102 26 7 338 3 trpS Tryptophan--tRNA ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P3 1.24e-23 102 26 7 338 3 trpS Tryptophan--tRNA ligase Salmonella typhi
Q7MH15 1.3e-23 102 26 9 349 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain YJ016)
Q8DCT6 1.3e-23 102 26 9 349 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain CMCP6)
Q8D1X5 1.36e-23 102 28 10 343 3 trpS Tryptophan--tRNA ligase Wigglesworthia glossinidia brevipalpis
Q82E91 1.65e-23 102 25 5 332 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8RXE9 1.68e-23 103 27 7 347 1 OVA4 Tryptophan--tRNA ligase, chloroplastic/mitochondrial Arabidopsis thaliana
P56396 3e-23 101 27 11 336 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
Q7VRN5 3.55e-23 101 32 6 229 3 trpS Tryptophan--tRNA ligase Blochmanniella floridana
Q929H5 4.54e-23 100 27 10 340 3 trpS Tryptophan--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9PQW8 5.06e-23 100 26 11 339 3 trpS Tryptophan--tRNA ligase Ureaplasma parvum serovar 3 (strain ATCC 700970)
O42875 1.1e-22 100 27 10 357 3 msw1 Tryptophan--tRNA ligase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3T099 1.25e-22 100 27 7 332 2 WARS2 Tryptophan--tRNA ligase, mitochondrial Bos taurus
Q82HU1 1.92e-22 99 26 8 342 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P59466 3.8e-22 98 28 9 337 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9ZJX4 7.55e-22 97 27 12 336 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
Q49901 8.29e-22 97 25 8 333 3 trpS Tryptophan--tRNA ligase Mycobacterium leprae (strain TN)
C0HKD6 1.07e-21 97 25 8 339 2 wars-2 Tryptophan--tRNA ligase, mitochondrial Caenorhabditis elegans
P75510 8.28e-21 95 26 9 340 1 trpS Tryptophan--tRNA ligase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q7NAT8 1.15e-20 94 24 11 355 3 trpS Tryptophan--tRNA ligase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q8EVV1 1.34e-20 94 25 10 336 3 trpS Tryptophan--tRNA ligase Malacoplasma penetrans (strain HF-2)
Q8K941 1.66e-20 94 26 9 337 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P04803 3.83e-20 93 26 10 345 1 MSW1 Tryptophan--tRNA ligase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q86A90 2.8e-18 88 26 6 322 3 wars2 Tryptophan--tRNA ligase, mitochondrial Dictyostelium discoideum
Q8UIE8 3.8e-18 87 26 9 369 3 trpS Tryptophan--tRNA ligase Agrobacterium fabrum (strain C58 / ATCC 33970)
P47372 1.59e-17 85 25 9 340 3 trpS Tryptophan--tRNA ligase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9HN66 3.36e-17 85 24 7 313 3 trpS2 Tryptophan--tRNA ligase 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O27795 7.67e-14 74 24 9 317 3 tyrS Tyrosine--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A5UKJ0 2.23e-10 64 22 8 295 3 tyrS Tyrosine--tRNA ligase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q6M0K7 1.93e-09 61 24 13 330 3 tyrS Tyrosine--tRNA ligase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q5V4J1 2.82e-08 58 24 9 245 3 tyrS Tyrosine--tRNA ligase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A6URQ1 1.16e-07 56 23 16 332 3 tyrS Tyrosine--tRNA ligase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6AJ82 1.47e-07 56 30 12 232 3 tyrS Tyrosine--tRNA ligase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q57834 2.7e-07 55 21 10 319 1 tyrS Tyrosine--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B6YUH1 3.08e-07 55 24 15 323 3 trpS Tryptophan--tRNA ligase Thermococcus onnurineus (strain NA1)
A4WN67 5.13e-07 54 25 10 285 3 tyrS Tyrosine--tRNA ligase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
Q7VHY1 1.04e-06 53 29 12 244 3 tyrS Tyrosine--tRNA ligase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q39WF4 1.31e-06 53 29 12 228 3 tyrS Tyrosine--tRNA ligase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8U453 1.7e-06 52 24 17 330 3 trpS Tryptophan--tRNA ligase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9UY11 1.8e-06 52 24 15 325 3 trpS Tryptophan--tRNA ligase Pyrococcus abyssi (strain GE5 / Orsay)
O59584 2.1e-06 52 23 15 325 1 trpS Tryptophan--tRNA ligase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q74E25 2.37e-06 52 29 12 228 3 tyrS Tyrosine--tRNA ligase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9HN62 4.88e-06 51 26 10 246 3 tyrS Tyrosine--tRNA ligase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R7E0 4.88e-06 51 26 10 246 3 tyrS Tyrosine--tRNA ligase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q5JEP3 7.31e-06 50 23 16 328 3 trpS Tryptophan--tRNA ligase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8TYF7 1.07e-05 50 24 15 319 3 trpS Tryptophan--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q58810 1.18e-05 50 25 12 310 3 trpS Tryptophan--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8ZYT7 1.19e-05 50 24 10 285 3 tyrS1 Tyrosine--tRNA ligase 1 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q2NHE1 1.23e-05 50 21 9 319 3 tyrS Tyrosine--tRNA ligase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
B9LTA6 1.79e-05 49 21 8 302 3 tyrS Tyrosine--tRNA ligase Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Q12W06 2.01e-05 49 23 13 310 3 tyrS Tyrosine--tRNA ligase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
A3CYG9 2.17e-05 49 22 8 274 3 tyrS Tyrosine--tRNA ligase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q2RHS8 2.97e-05 49 27 10 221 3 tyrS Tyrosine--tRNA ligase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9Y924 4.38e-05 48 23 10 237 1 trpS Tryptophan--tRNA ligase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
A3MXW0 5.18e-05 48 22 11 324 3 tyrS Tyrosine--tRNA ligase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q60AU5 5.2e-05 48 26 9 227 3 tyrS Tyrosine--tRNA ligase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q65T71 5.28e-05 48 26 11 246 3 tyrS Tyrosine--tRNA ligase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CMQ8 5.92e-05 48 28 12 243 3 tyrS Tyrosine--tRNA ligase Pasteurella multocida (strain Pm70)
A1RSH9 6.78e-05 47 24 10 285 3 tyrS Tyrosine--tRNA ligase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Q4JBG7 8.32e-05 47 22 14 337 3 trpS Tryptophan--tRNA ligase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q5P7U2 8.44e-05 47 26 10 230 3 tyrS Tyrosine--tRNA ligase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7VN81 9.43e-05 47 27 12 245 3 tyrS Tyrosine--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P43836 0.000107 47 26 12 243 3 tyrS Tyrosine--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8KEW9 0.000122 47 26 10 233 3 tyrS Tyrosine--tRNA ligase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q4QL45 0.000152 47 26 12 243 3 tyrS Tyrosine--tRNA ligase Haemophilus influenzae (strain 86-028NP)
Q3IQU8 0.000153 46 23 9 242 3 tyrS Tyrosine--tRNA ligase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q3SLJ8 0.000158 47 26 18 338 3 tyrS Tyrosine--tRNA ligase Thiobacillus denitrificans (strain ATCC 25259)
C6A032 0.000225 46 23 15 333 3 trpS Tryptophan--tRNA ligase Thermococcus sibiricus (strain DSM 12597 / MM 739)
Q2FNA1 0.000363 45 22 13 319 3 tyrS Tyrosine--tRNA ligase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q9ZL69 0.000384 45 27 10 246 3 tyrS Tyrosine--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
P32921 0.000566 45 23 11 313 1 Wars1 Tryptophan--tRNA ligase, cytoplasmic Mus musculus
Q3JCM3 0.000598 45 26 9 230 3 tyrS Tyrosine--tRNA ligase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3A220 0.000632 45 27 12 229 3 tyrS Tyrosine--tRNA ligase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q47V01 0.000765 44 28 11 227 3 tyrS Tyrosine--tRNA ligase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A2SU89 0.0009 44 23 13 323 3 tyrS Tyrosine--tRNA ligase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08460
Feature type CDS
Gene trpS
Product tryptophan--tRNA ligase
Location 1842876 - 1843895 (strand: -1)
Length 1020 (nucleotides) / 339 (amino acids)
In genomic island GI57

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_620
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00579 tRNA synthetases class I (W and Y)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0180 Translation, ribosomal structure and biogenesis (J) J Tryptophanyl-tRNA synthetase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] Aminoacyl-tRNA biosynthesis -

Protein Sequence

MNKYLTENKSIVLTGDRITGPLHLGHYIGSLQQRVEFQKKATQYILMADMQGLTDNGSTPEKVSKFLFDVVADYLAVGIDPKLSTLCLQSALPALSELTMLYLNIVTVSRLERNPTVKHEILQKNLSRSLPAGFLTYPVSQAADITAFSADIVPAGEDQLPMIEQTNEIVTKINSLIGQPVLTSCKVVVGQVGRLPGTDGSGKMSKSLGNTINLSSTADEIKKAVYSMYTDPQHIDVASPGHIEGNVVFTYLDAFCQDKAMVTAMKAHYQRGGLGDMKCKAMLNDILQELLQPIREKRAQLINDKAYLLQVIKEGSDKAKEVTQQKLDEVKRGLGLLIL

Flanking regions ( +/- flanking 50bp)

GTTGTTTATGGCATTTCTCTGGCGGTATTTATCCCAACGAAGGAAATGCAATGAACAAATATCTCACTGAAAATAAATCGATAGTTTTAACAGGGGATCGGATCACTGGACCTTTACATCTTGGTCATTATATTGGCTCTCTTCAGCAACGTGTCGAATTTCAGAAGAAAGCGACACAATATATCTTAATGGCTGATATGCAAGGGTTAACCGATAATGGCTCAACACCTGAAAAGGTCAGTAAATTTCTTTTTGATGTGGTGGCTGATTATTTAGCTGTTGGTATTGATCCGAAACTTTCCACATTATGCTTACAATCCGCACTACCGGCTTTATCAGAACTGACTATGCTGTATTTAAATATTGTCACAGTATCTCGCTTAGAGCGTAATCCAACAGTAAAACATGAGATTTTGCAAAAAAATCTTTCTCGTTCATTGCCGGCGGGATTTTTAACCTATCCTGTCAGTCAAGCGGCGGATATTACTGCATTTAGTGCAGATATTGTGCCCGCAGGAGAAGATCAATTACCTATGATTGAGCAAACCAATGAAATCGTCACCAAAATAAATAGCTTAATAGGACAACCCGTATTGACAAGTTGTAAGGTCGTAGTAGGGCAAGTCGGTCGTTTACCCGGTACAGATGGTAGTGGGAAAATGTCTAAATCCTTAGGTAATACGATTAATTTATCATCCACAGCCGATGAAATTAAAAAAGCGGTTTATTCGATGTATACCGATCCGCAACATATTGATGTTGCATCACCAGGTCATATTGAAGGTAATGTGGTGTTCACCTATTTAGATGCTTTTTGCCAAGATAAAGCCATGGTGACGGCAATGAAGGCTCATTACCAAAGAGGAGGACTTGGTGATATGAAATGCAAAGCTATGCTTAATGATATCTTACAAGAGCTTCTGCAACCAATACGTGAAAAAAGAGCGCAACTTATTAATGATAAAGCTTATTTATTACAAGTGATCAAAGAAGGGAGCGATAAAGCGAAAGAAGTGACTCAACAAAAGCTTGATGAAGTAAAACGTGGTCTAGGATTATTGATCTTGTGAGCTATTGTATTTAAAAAAGCTAACATTAGGCTTAACGGTGAATATCAGTA