Homologs in group_504

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00990 FBDBKF_00990 89.8 Morganella morganii S1 cysT sulfate/thiosulfate ABC transporter permease CysT
EHELCC_00555 EHELCC_00555 89.8 Morganella morganii S2 cysT sulfate/thiosulfate ABC transporter permease CysT
NLDBIP_02905 NLDBIP_02905 89.8 Morganella morganii S4 cysT sulfate/thiosulfate ABC transporter permease CysT
LHKJJB_04420 LHKJJB_04420 89.8 Morganella morganii S3 cysT sulfate/thiosulfate ABC transporter permease CysT
HKOGLL_02625 HKOGLL_02625 89.8 Morganella morganii S5 cysT sulfate/thiosulfate ABC transporter permease CysT
PMI_RS09050 PMI_RS09050 73.6 Proteus mirabilis HI4320 cysT sulfate/thiosulfate ABC transporter permease CysT

Distribution of the homologs in the orthogroup group_504

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_504

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P41032 1.37e-130 374 75 0 271 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P16701 1.45e-128 369 75 0 271 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
Q9MUL9 7.04e-81 247 49 0 249 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
A2CI71 8.28e-77 238 48 0 249 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
Q9TKU8 2.14e-75 234 48 0 251 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q32RF7 8.74e-73 228 46 0 246 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
Q9TJR4 1.82e-71 223 45 0 240 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
P26246 4.4e-71 223 43 0 260 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
P27367 2.35e-68 216 48 0 250 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2EEX6 3.41e-68 215 45 0 248 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
Q8RVC7 5.59e-64 209 44 0 250 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
Q01895 8.75e-64 204 48 0 217 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P56343 1.15e-63 203 44 0 237 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
Q85AI0 9.94e-60 194 40 0 260 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
P27370 1.13e-42 150 33 0 258 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74547 3.58e-42 148 39 0 214 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0AEB0 2.97e-38 139 35 3 257 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 2.97e-38 139 35 3 257 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6QJE2 6.74e-37 137 35 0 227 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
O30143 2.59e-30 117 31 3 248 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P45322 9.75e-29 112 33 1 183 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AF01 1.06e-26 107 33 2 228 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 1.06e-26 107 33 2 228 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
Q58763 8.33e-26 105 30 4 214 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P18795 3.62e-24 101 33 1 172 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
Q08382 1.47e-20 90 31 2 195 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
P9WG13 1.84e-20 91 31 2 213 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 1.84e-20 91 31 2 213 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 1.84e-20 91 31 2 213 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P37731 4.97e-20 89 30 1 209 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
O57893 1.64e-19 88 23 3 230 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V2C1 2.77e-19 87 25 4 237 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
Q5JEB3 2.11e-18 85 25 2 209 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8U4K4 9.81e-18 83 24 2 211 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
D4GQ17 9.93e-17 81 30 1 169 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O32209 7.78e-16 77 27 1 204 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
P96064 2.6e-13 71 26 5 256 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 3.35e-13 71 26 5 256 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57SD7 3.99e-13 71 26 5 256 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
Q83RR7 1.61e-12 69 28 3 230 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P0AFK6 2.14e-12 68 28 4 233 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 2.14e-12 68 28 4 233 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 2.14e-12 68 28 4 233 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q8Z8W9 2.96e-12 68 26 5 256 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
Q44123 1.4e-11 67 27 3 196 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q44123 3.04e-11 67 27 4 194 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
P0AFK5 6.52e-11 64 27 4 209 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 6.52e-11 64 27 4 209 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
Q57341 2.33e-10 64 27 4 166 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57341 1.18e-07 56 29 2 155 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0CL49 3.81e-10 62 27 4 210 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 3.81e-10 62 27 4 210 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 3.81e-10 62 27 4 210 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
P45169 7.74e-10 61 26 3 227 3 potC Spermidine/putrescine transport system permease protein PotC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45170 8.32e-09 58 29 3 132 3 potB Spermidine/putrescine transport system permease protein PotB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71338 1.37e-08 58 28 5 187 3 fbpB2 Fe(3+)-transport system permease protein FbpB 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFL1 1.86e-08 57 28 7 250 1 potI Putrescine transport system permease protein PotI Escherichia coli (strain K12)
P0AFL2 1.86e-08 57 28 7 250 3 potI Putrescine transport system permease protein PotI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q93KD5 1.05e-07 55 25 3 168 1 tupB Tungstate uptake system permease protein TupB Peptoclostridium acidaminophilum
Q57380 1.32e-07 52 27 0 117 5 HI_1475 Putative uncharacterized protein HI_1475 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P21409 1.53e-07 55 25 6 215 3 fbpB Fe(3+)-transport system permease protein SfuB Serratia marcescens
Q8FYV0 1.04e-06 53 30 6 192 3 thiP Thiamine transport system permease protein ThiP Brucella suis biovar 1 (strain 1330)
P55602 1.52e-06 52 25 6 216 3 NGR_a02190 Probable ABC transporter permease protein y4oQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q57BC3 1.55e-06 52 30 6 192 3 thiP Thiamine transport system permease protein ThiP Brucella abortus biovar 1 (strain 9-941)
Q2YLW7 1.55e-06 52 30 6 192 3 thiP Thiamine transport system permease protein ThiP Brucella abortus (strain 2308)
Q7CS31 2.49e-06 51 25 5 215 1 smoH Sulfoquinovosyl glycerol transport system permease protein SmoH Agrobacterium fabrum (strain C58 / ATCC 33970)
O58760 2.57e-06 51 22 2 170 3 PH1036 Probable ABC transporter permease protein PH1036 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q0P886 2.74e-06 50 20 2 207 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8YJ03 6.98e-06 50 29 6 192 3 thiP Thiamine transport system permease protein ThiP Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P44985 7.28e-06 50 25 3 199 3 thiP Thiamine transport system permease protein ThiP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WG01 9.36e-06 49 25 5 215 1 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG00 9.36e-06 49 25 5 215 3 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8ZRV1 9.7e-06 50 25 7 210 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31135 1.11e-05 49 23 5 244 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
P31549 1.23e-05 49 25 7 204 1 thiP Thiamine transport system permease protein ThiP Escherichia coli (strain K12)
P47290 2.69e-05 48 21 3 164 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P77156 3.31e-05 48 24 3 188 1 ydcU Inner membrane ABC transporter permease protein YdcU Escherichia coli (strain K12)
Q9PBK1 0.000131 46 27 3 129 3 pstA Phosphate transport system permease protein PstA Xylella fastidiosa (strain 9a5c)
Q87C89 0.000158 45 27 3 129 3 pstA Phosphate transport system permease protein PstA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P46339 0.000214 45 23 3 169 3 yqgH Probable ABC transporter permease protein YqgH Bacillus subtilis (strain 168)
P55452 0.000492 45 26 2 130 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55452 0.000501 45 26 3 170 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q87C90 0.00054 44 29 0 75 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PBK2 0.000613 44 29 0 75 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain 9a5c)
O50501 0.000623 44 24 3 164 1 ngcG Diacetylchitobiose uptake system permease protein NgcG Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0AGI0 0.000746 43 29 0 78 3 pstC Phosphate transport system permease protein PstC Shigella flexneri
P0AGH8 0.000746 43 29 0 78 1 pstC Phosphate transport system permease protein PstC Escherichia coli (strain K12)
P0AGH9 0.000746 43 29 0 78 3 pstC Phosphate transport system permease protein PstC Escherichia coli O157:H7
Q9K489 0.00085 43 23 5 178 1 dasC Diacetylchitobiose uptake system permease protein DasC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07065
Feature type CDS
Gene cysT
Product sulfate/thiosulfate ABC transporter permease CysT
Location 1466473 - 1467300 (strand: -1)
Length 828 (nucleotides) / 275 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_504
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0555 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02046 sulfate/thiosulfate transport system permease protein Sulfur metabolism
ABC transporters		 Sulfate-sulfur assimilation

Protein Sequence

MSRRVLPGFGLSLGFTLLYTGLILLLPLTALVMQLAQMSWSQYWNVITSPQVVAAYGVTLKAALAASLFNAVFGILMAWILTRYRFPGRRILDGLMDLPFALPTAVAGLTLATLFAPDGWYGRFFHSFDITVVNTWVGIAVAMAFTSIPFVVRTVQPVLESLKPEYEEAAETLGASRLQIFYRVIWPEIAPAALAGTVLSFTRSLGEFGAVIFIAGNLAWKTEVVSFLIFVRLQEFDFPAATAIASVILMASLVLLLTVNIIQSRVGLRTGGAHG

Flanking regions ( +/- flanking 50bp)

GTTTAATTCAGGCGGTGAATTCGATACGCTGATGGCACAAGGCCGCTGATATGTCGCGGCGGGTTTTACCGGGTTTCGGGCTTTCCCTTGGCTTTACGCTGCTCTATACCGGGCTGATTTTATTGCTGCCTCTGACTGCGCTGGTGATGCAACTGGCGCAGATGAGCTGGTCGCAGTACTGGAATGTGATCACAAGCCCGCAGGTGGTTGCCGCGTATGGCGTTACACTTAAAGCCGCGCTGGCCGCAAGCCTGTTCAATGCCGTTTTCGGCATACTGATGGCGTGGATACTGACGCGCTACCGCTTTCCCGGCCGCCGCATTCTGGACGGACTGATGGATCTGCCCTTTGCTTTACCCACGGCAGTCGCAGGGCTGACACTCGCCACACTCTTTGCGCCGGACGGCTGGTATGGACGTTTTTTTCACTCTTTTGATATCACCGTCGTGAATACCTGGGTGGGAATTGCAGTCGCTATGGCATTCACCAGTATCCCGTTTGTGGTCCGCACTGTGCAGCCGGTACTGGAATCGCTGAAGCCGGAGTATGAAGAGGCCGCAGAAACCCTGGGCGCATCCCGCCTGCAAATTTTTTACCGTGTTATCTGGCCGGAAATTGCTCCTGCGGCGCTGGCAGGGACTGTTTTGTCTTTTACCCGCAGCCTGGGTGAGTTTGGTGCGGTGATTTTTATTGCCGGAAATCTGGCATGGAAAACAGAAGTTGTCTCATTTTTGATTTTTGTCCGTTTACAGGAATTTGATTTCCCTGCCGCCACTGCGATTGCATCCGTTATTCTGATGGCATCGCTGGTATTGCTTCTTACCGTCAATATTATTCAGAGCCGTGTTGGTTTGCGGACAGGCGGGGCACATGGCTGATAATTTCCGTCGCCGCCCGCGTTTTGCGTGGCAAAAATGGTTGCTGATTG