Homologs in group_580

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00555 EHELCC_00555 100.0 Morganella morganii S2 cysT sulfate/thiosulfate ABC transporter permease CysT
NLDBIP_02905 NLDBIP_02905 100.0 Morganella morganii S4 cysT sulfate/thiosulfate ABC transporter permease CysT
LHKJJB_04420 LHKJJB_04420 100.0 Morganella morganii S3 cysT sulfate/thiosulfate ABC transporter permease CysT
HKOGLL_02625 HKOGLL_02625 100.0 Morganella morganii S5 cysT sulfate/thiosulfate ABC transporter permease CysT
F4V73_RS07065 F4V73_RS07065 89.8 Morganella psychrotolerans cysT sulfate/thiosulfate ABC transporter permease CysT
PMI_RS09050 PMI_RS09050 74.4 Proteus mirabilis HI4320 cysT sulfate/thiosulfate ABC transporter permease CysT

Distribution of the homologs in the orthogroup group_580

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_580

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P16701 1.97e-128 368 74 0 268 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
P41032 6.17e-127 365 73 0 268 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9MUL9 2.26e-77 238 47 0 249 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
A2CI71 1.41e-76 237 47 0 249 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
Q9TKU8 5.63e-75 233 49 0 251 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q32RF7 3.96e-74 231 47 0 246 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
P26246 4.07e-70 221 44 0 260 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
Q9TJR4 8.6e-70 219 45 0 240 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
Q2EEX6 4.73e-69 217 46 0 246 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P27367 1.25e-67 214 48 0 257 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q01895 2.15e-63 203 48 0 217 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P56343 1.14e-62 201 45 0 237 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
Q8RVC7 1.47e-61 202 43 0 252 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
Q85AI0 4.09e-59 192 39 0 260 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
P27370 5.04e-44 154 33 2 281 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74547 1.87e-41 147 38 0 214 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0AEB0 7.86e-41 145 33 2 275 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 7.86e-41 145 33 2 275 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6QJE2 7.86e-38 139 36 0 227 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
O30143 7.58e-30 116 31 4 250 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P45322 7.85e-27 107 32 1 183 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AF01 4e-25 102 36 3 193 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 4e-25 102 36 3 193 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
Q58763 8.09e-25 102 30 4 208 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P18795 7.37e-23 98 27 2 222 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
Q08382 2.03e-21 92 32 1 195 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
Q5JEB3 7.61e-21 92 27 3 211 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P37731 3.03e-20 89 32 2 218 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
O57893 4.39e-20 89 24 3 230 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V2C1 4.53e-20 89 27 2 202 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
P9WG13 6.01e-20 89 32 2 214 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 6.01e-20 89 32 2 214 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 6.01e-20 89 32 2 214 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8U4K4 2.08e-17 82 23 2 213 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
D4GQ17 3.61e-16 79 31 3 189 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O32209 9.72e-16 77 27 3 210 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
P0AFK6 2.74e-13 71 29 4 224 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 2.74e-13 71 29 4 224 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 2.74e-13 71 29 4 224 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q83RR7 2.82e-13 71 29 4 224 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P96064 2.31e-12 68 26 5 243 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 3.14e-12 68 26 5 243 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q44123 8.49e-12 68 25 2 192 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q44123 6.55e-11 65 27 2 199 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q57SD7 2.04e-11 66 26 5 243 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
Q8Z8W9 2.46e-11 66 26 5 242 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
Q57341 3.05e-10 63 24 3 226 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57341 6.26e-09 60 30 1 156 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71338 4.48e-09 60 26 5 234 3 fbpB2 Fe(3+)-transport system permease protein FbpB 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45169 1.3e-08 57 25 2 227 3 potC Spermidine/putrescine transport system permease protein PotC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45170 3.43e-08 57 28 2 132 3 potB Spermidine/putrescine transport system permease protein PotB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0P886 2.84e-07 53 20 2 206 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P0AFK5 3.92e-07 53 25 2 199 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 3.92e-07 53 25 2 199 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
P0CL49 1.58e-06 52 25 2 204 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 1.58e-06 52 25 2 204 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 1.58e-06 52 25 2 204 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
Q93KD5 1.95e-06 51 32 1 88 1 tupB Tungstate uptake system permease protein TupB Peptoclostridium acidaminophilum
Q8FYV0 2.65e-06 52 28 6 194 3 thiP Thiamine transport system permease protein ThiP Brucella suis biovar 1 (strain 1330)
Q57380 3.23e-06 48 24 0 114 5 HI_1475 Putative uncharacterized protein HI_1475 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31549 4e-06 51 24 6 241 1 thiP Thiamine transport system permease protein ThiP Escherichia coli (strain K12)
P0AFL1 4.03e-06 50 26 8 248 1 potI Putrescine transport system permease protein PotI Escherichia coli (strain K12)
P0AFL2 4.03e-06 50 26 8 248 3 potI Putrescine transport system permease protein PotI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O58760 4.2e-06 50 24 1 152 3 PH1036 Probable ABC transporter permease protein PH1036 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q57BC3 4.48e-06 51 28 6 194 3 thiP Thiamine transport system permease protein ThiP Brucella abortus biovar 1 (strain 9-941)
Q2YLW7 4.48e-06 51 28 6 194 3 thiP Thiamine transport system permease protein ThiP Brucella abortus (strain 2308)
P9WG01 4.6e-06 50 24 5 243 1 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG00 4.6e-06 50 24 5 243 3 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8ZRV1 7.88e-06 50 25 6 248 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87C89 9.04e-06 49 27 3 129 3 pstA Phosphate transport system permease protein PstA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PBK1 9.82e-06 49 27 3 129 3 pstA Phosphate transport system permease protein PstA Xylella fastidiosa (strain 9a5c)
Q8YJ03 1.57e-05 49 27 6 194 3 thiP Thiamine transport system permease protein ThiP Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P44985 2.35e-05 48 25 3 199 3 thiP Thiamine transport system permease protein ThiP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P21409 2.8e-05 48 28 6 181 3 fbpB Fe(3+)-transport system permease protein SfuB Serratia marcescens
P55452 5.22e-05 47 28 2 130 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P77156 5.47e-05 47 28 1 99 1 ydcU Inner membrane ABC transporter permease protein YdcU Escherichia coli (strain K12)
P47290 0.000116 46 23 5 160 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9PBK2 0.00039 44 31 1 80 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain 9a5c)
Q87C90 0.000393 44 31 1 80 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P45191 0.00047 44 32 1 80 3 pstC Phosphate transport system permease protein PstC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31135 0.000608 44 23 2 144 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
P46339 0.000618 44 23 3 168 3 yqgH Probable ABC transporter permease protein YqgH Bacillus subtilis (strain 168)
Q87GB8 0.000735 43 27 4 187 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q58420 0.001 43 33 2 80 3 pstC Probable phosphate transport system permease protein PstC Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00990
Feature type CDS
Gene cysT
Product sulfate/thiosulfate ABC transporter permease CysT
Location 179977 - 180804 (strand: -1)
Length 828 (nucleotides) / 275 (amino acids)
In genomic island -

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_580
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0555 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02046 sulfate/thiosulfate transport system permease protein Sulfur metabolism
ABC transporters
Sulfate-sulfur assimilation

Protein Sequence

MARRVLPGFGLSLGFTLLYSGLILLLPLTALVLQLAQMSWAQYWQVITGPQVVAAYKVTLLAALAASLFNAVFGVLMAWILTRYRFPGCRILDGLMDLPFALPTAVAGLTLATLFAPNGWYGRFFDSFNITVVNTWIGIAVAMMFTSIPFVVRTVQPVLETLKPEYEEAAETLGASRFQIFCRVIWPEIAPAALAGTVLSFTRSLGEFGAVIFIAGNLAWQTEVVSFLIFVRLQEFEYPAAAAIASVVLMTSLVLLLAVNIIQSRAGLRTGRSHG

Flanking regions ( +/- flanking 50bp)

GTTCAATTCAGGCGGTGAATTTGACACCCTGATGGCTCAGGGACGCTGATATGGCAAGACGGGTGTTGCCGGGATTTGGCCTGTCCCTCGGGTTTACGCTGCTCTACAGCGGACTGATCCTGCTGCTGCCCCTCACTGCACTGGTATTACAGCTGGCGCAGATGAGCTGGGCGCAGTACTGGCAGGTGATCACCGGCCCGCAGGTGGTCGCCGCTTATAAAGTCACACTGCTCGCCGCGCTTGCTGCCAGTCTGTTTAATGCAGTGTTTGGTGTGCTGATGGCCTGGATCCTGACCCGCTACCGCTTTCCCGGCTGCCGTATTCTCGACGGCCTGATGGATTTGCCCTTTGCGCTGCCCACGGCGGTTGCGGGGCTGACACTCGCCACTCTCTTTGCCCCGAACGGCTGGTACGGCCGTTTTTTTGATTCGTTTAATATCACCGTGGTGAATACCTGGATTGGTATTGCGGTCGCGATGATGTTTACCAGTATCCCGTTTGTGGTCCGCACGGTACAACCGGTGCTGGAAACTCTGAAACCGGAGTATGAGGAAGCGGCAGAAACGCTGGGTGCTTCGCGTTTTCAGATATTCTGCCGTGTGATCTGGCCGGAAATCGCCCCGGCAGCACTGGCGGGAACCGTTTTGTCCTTTACCCGCAGCCTTGGTGAGTTCGGTGCGGTGATTTTTATCGCCGGTAACCTGGCGTGGCAGACGGAAGTGGTGTCATTCCTGATTTTTGTCCGCCTCCAGGAGTTTGAATACCCGGCGGCTGCGGCGATTGCCTCGGTGGTGCTGATGACTTCGCTGGTGTTATTGCTGGCGGTCAATATTATTCAGAGCCGCGCCGGATTGCGTACCGGGAGGTCTCATGGCTGATACACTACGCCGCCGGCGTTTCCCGTGGCAGAAGTGGCTGCTGATTTCTG