Homologs in group_496

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00905 FBDBKF_00905 86.2 Morganella morganii S1 ttrR tetrathionate respiration response regulator TtrR
EHELCC_00640 EHELCC_00640 86.2 Morganella morganii S2 ttrR tetrathionate respiration response regulator TtrR
NLDBIP_02820 NLDBIP_02820 86.2 Morganella morganii S4 ttrR tetrathionate respiration response regulator TtrR
LHKJJB_04335 LHKJJB_04335 86.2 Morganella morganii S3 ttrR tetrathionate respiration response regulator TtrR
HKOGLL_02710 HKOGLL_02710 86.2 Morganella morganii S5 ttrR tetrathionate respiration response regulator TtrR
PMI_RS08245 PMI_RS08245 60.3 Proteus mirabilis HI4320 ttrR tetrathionate respiration response regulator TtrR

Distribution of the homologs in the orthogroup group_496

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_496

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQM8 1.67e-82 246 62 0 198 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23221 7.28e-44 148 40 1 188 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P10958 3e-36 129 40 2 188 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P26487 1.89e-34 124 40 3 189 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8KR08 2.47e-33 121 35 1 189 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q3LWR6 4.43e-33 121 35 3 190 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 4.43e-33 121 35 3 190 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 4.43e-33 121 35 3 190 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P15940 1.7e-29 112 33 2 198 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P37740 2.8e-27 105 33 2 189 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
O87940 4.86e-26 103 32 2 190 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q9HU19 6.63e-17 81 35 1 139 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P10046 8.17e-17 81 39 1 117 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q1XDE4 1.03e-15 75 25 3 182 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P13632 2.96e-14 73 34 0 129 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P72781 2.1e-13 69 28 4 213 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8X613 6.52e-13 69 34 0 117 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P14375 6.71e-13 69 34 0 117 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P0AGA9 9.21e-13 67 32 6 197 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 9.21e-13 67 32 6 197 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 9.21e-13 67 32 6 197 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 9.21e-13 67 32 6 197 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
P27667 9.03e-12 64 31 6 197 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0C5S3 1.29e-10 61 33 0 108 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
Q9APD9 1.47e-10 63 31 0 117 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P48359 1.59e-10 61 25 7 206 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
A6UEL7 2.01e-10 60 33 0 108 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
P0C5S5 3.48e-10 62 31 0 111 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 3.48e-10 62 31 0 111 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P25852 3.5e-10 62 30 0 123 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 3.6e-10 62 30 0 123 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q87MX7 3.86e-10 61 31 0 111 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P51343 4.71e-10 60 25 2 183 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q07783 9.25e-10 59 31 4 154 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
O34903 1.09e-09 59 31 2 132 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P41789 1.15e-09 60 28 1 123 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7MM78 1.41e-09 60 30 0 121 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 1.41e-09 60 30 0 121 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P48259 1.71e-09 58 29 3 146 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q7CQM5 2.11e-09 58 25 3 154 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P28787 2.37e-09 59 42 0 69 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P45337 3.12e-09 58 33 0 110 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P06184 3.24e-09 58 40 0 85 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42508 4.4e-09 57 31 2 110 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
Q9KT84 4.65e-09 58 30 0 111 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1M7A0 4.98e-09 57 27 2 148 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O78428 5.18e-09 57 29 2 144 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q00934 7.45e-09 58 26 3 147 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AFB8 7.9e-09 58 27 1 123 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 7.9e-09 58 27 1 123 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P50350 9.55e-09 57 33 1 109 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P13792 1.02e-08 56 29 0 108 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
A6WZ81 1.17e-08 56 25 1 153 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P96686 1.3e-08 56 25 5 210 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q8FZ93 1.31e-08 56 28 0 108 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.31e-08 56 28 0 108 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.31e-08 56 28 0 108 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.31e-08 56 28 0 108 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.31e-08 56 28 0 108 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.31e-08 56 28 0 108 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.31e-08 56 28 0 108 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.31e-08 56 28 0 108 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q49XM7 1.31e-08 56 29 1 113 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1TEL7 1.44e-08 56 32 2 147 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P0A4H8 1.64e-08 56 24 4 217 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.64e-08 56 24 4 217 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P50351 1.84e-08 56 33 3 113 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P23747 1.87e-08 57 31 0 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P35163 2.13e-08 55 26 7 207 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q53228 2.33e-08 55 32 2 110 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O82868 2.92e-08 54 31 2 114 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
P03029 3.5e-08 56 29 0 101 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q04849 3.52e-08 56 26 2 123 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
L7N689 3.6e-08 55 29 2 141 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9ZCY9 3.62e-08 55 28 3 121 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q88RJ6 3.75e-08 55 27 0 128 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88AQ2 3.93e-08 55 27 0 128 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P36556 4.07e-08 55 29 3 152 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7A0U4 5.18e-08 54 24 7 210 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 5.18e-08 54 24 7 210 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 5.18e-08 54 24 7 210 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 5.18e-08 54 24 7 210 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 5.18e-08 54 24 7 210 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 5.18e-08 54 24 7 210 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 5.18e-08 54 24 7 210 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 5.18e-08 54 24 7 210 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q1RJS1 5.91e-08 55 26 3 121 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q92HC2 6.6e-08 55 26 3 121 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q47456 6.63e-08 54 28 2 155 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q9CD68 6.81e-08 54 30 1 143 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P28835 7.37e-08 54 28 1 123 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
B8H358 9.19e-08 53 27 0 98 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 9.19e-08 53 27 0 98 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O25408 1.32e-07 54 30 3 119 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
Q9TLQ4 1.52e-07 53 31 1 108 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q55890 1.61e-07 53 29 2 152 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A4H2 1.85e-07 52 26 5 196 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 1.85e-07 52 26 5 196 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 1.85e-07 52 26 5 196 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q4UL27 1.91e-07 53 25 3 121 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68WH4 1.93e-07 53 26 3 121 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A1KHB7 2.07e-07 53 30 1 142 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 2.07e-07 53 30 1 142 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q06065 2.12e-07 53 26 3 149 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q8DPL7 2.3e-07 52 27 1 111 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 2.3e-07 52 27 1 111 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 2.3e-07 52 27 1 111 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O25918 2.82e-07 52 25 1 113 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P0AEL8 3.98e-07 52 24 2 150 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 3.98e-07 52 24 2 150 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
P9WGM9 4.59e-07 52 30 1 142 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 4.59e-07 52 30 1 142 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 4.59e-07 52 30 1 142 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P0A4I0 4.59e-07 52 30 1 120 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 4.59e-07 52 30 1 120 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
A0R3I8 4.77e-07 52 29 2 145 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P30843 4.79e-07 52 28 3 152 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P28257 4.81e-07 52 30 1 110 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q1B3X8 5.41e-07 52 31 3 149 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 5.41e-07 52 31 3 149 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 5.41e-07 52 31 3 149 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q9K621 5.5e-07 51 30 2 126 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9HWA4 5.63e-07 52 33 3 115 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0PWB4 6.66e-07 51 30 2 144 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q49VK3 7.61e-07 51 27 4 144 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9ZHD3 1.2e-06 50 31 0 108 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q6GJ11 1.47e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q7A1L2 1.53e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1.53e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1.53e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1.53e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1.53e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1.53e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8Z181 1.54e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.54e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.54e-06 50 30 4 140 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.54e-06 50 30 4 140 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.54e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q2YSS2 1.58e-06 50 30 4 140 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q932F1 1.59e-06 50 30 4 140 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P52076 1.62e-06 50 27 3 140 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q8XBS3 1.62e-06 50 27 1 138 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P0DMK7 1.68e-06 50 33 1 100 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 1.68e-06 50 33 1 100 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
P0C001 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.7e-06 50 26 1 113 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.7e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q99U73 1.73e-06 50 26 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P44918 1.85e-06 50 29 2 125 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38889 2.19e-06 50 28 0 110 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9AE24 2.2e-06 50 22 5 213 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q8CQ37 2.21e-06 50 34 3 111 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 2.21e-06 50 34 3 111 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0ACZ8 2.59e-06 49 31 3 117 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.59e-06 49 31 3 117 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.59e-06 49 31 3 117 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P26319 2.8e-06 49 22 3 166 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O78417 3.34e-06 49 22 5 193 3 ycf29 Probable transcriptional regulator ycf29 Guillardia theta
P51358 3.54e-06 49 28 4 146 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P37478 3.61e-06 49 24 3 141 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q1XDC9 3.64e-06 49 28 4 146 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P0A9Q4 3.85e-06 49 26 1 108 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 3.85e-06 49 26 1 108 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 3.85e-06 49 26 1 108 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 3.85e-06 49 26 1 108 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q44006 4.13e-06 49 31 1 110 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P26275 4.2e-06 49 42 1 70 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P66795 4.52e-06 48 28 1 135 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 4.52e-06 48 28 1 135 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q8CQK0 4.84e-06 48 26 5 175 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 4.84e-06 48 26 5 175 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0AED6 5.09e-06 48 23 5 197 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 5.09e-06 48 23 5 197 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P94413 6.84e-06 48 25 3 144 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q31S42 6.86e-06 48 30 2 139 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P66797 6.93e-06 48 23 2 144 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 6.93e-06 48 23 2 144 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q4UU85 7.27e-06 49 26 2 112 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q7A216 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 7.53e-06 48 31 1 106 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 7.53e-06 48 31 1 106 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 7.53e-06 48 31 1 106 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 7.53e-06 48 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5A4X5 7.88e-06 49 29 1 116 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
O49397 8.62e-06 48 32 2 106 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P0CL17 8.85e-06 48 33 4 117 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 8.85e-06 48 33 4 117 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
O05251 8.88e-06 48 32 1 80 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q742C1 9.18e-06 48 30 2 143 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 9.18e-06 48 30 2 143 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P0AFU5 9.89e-06 48 29 0 122 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 9.89e-06 48 29 0 122 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q9I4N3 9.92e-06 48 28 0 104 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9F868 1.41e-05 47 26 1 113 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P58357 1.59e-05 47 30 4 113 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P38684 1.89e-05 47 30 2 110 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P44895 2.02e-05 47 35 3 122 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4LAJ9 2.26e-05 47 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q9I0I1 2.27e-05 47 27 1 122 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7WZY4 2.94e-05 46 40 0 55 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
P0AEC5 3e-05 47 31 4 116 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 3e-05 47 31 4 116 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 3e-05 47 31 4 116 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q9K998 3.54e-05 46 26 4 126 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q4L6C6 4.09e-05 46 24 1 113 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q7A0I0 4.24e-05 46 22 3 141 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 4.24e-05 46 22 3 141 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 4.24e-05 46 22 3 141 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 4.24e-05 46 22 3 141 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 4.24e-05 46 22 3 141 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 4.24e-05 46 22 3 141 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4A160 4.4e-05 46 28 2 125 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P32040 4.67e-05 46 25 2 147 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P0ACZ7 5.18e-05 45 22 2 156 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 5.18e-05 45 22 2 156 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 5.18e-05 45 22 2 156 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 5.18e-05 45 22 2 156 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
P9WGL9 5.45e-05 45 26 1 113 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 5.45e-05 45 26 1 113 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 5.45e-05 45 26 1 113 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7A029 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 5.48e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE42 5.53e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q2YZ42 5.53e-05 45 40 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L8Q6 6.26e-05 45 24 3 162 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
Q7A1J1 6.63e-05 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 6.63e-05 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 6.63e-05 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 6.63e-05 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 6.63e-05 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 6.63e-05 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 6.63e-05 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 6.63e-05 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 6.63e-05 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 6.63e-05 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
G3XCY6 6.86e-05 45 31 3 124 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8R3S7 7.36e-05 45 26 4 199 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
O69730 8.36e-05 45 25 0 102 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q95PI2 8.39e-05 46 29 2 120 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
P42244 8.48e-05 45 26 2 119 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P10576 0.000104 45 24 0 130 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q8GP20 0.000106 45 28 3 122 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P59342 0.000123 45 31 4 116 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P94439 0.000131 44 24 3 152 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q70FH0 0.000145 44 29 1 98 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
P45365 0.000149 45 21 3 158 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q02540 0.00016 44 36 0 74 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P55701 0.000188 44 32 1 80 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2NB98 0.000191 44 39 0 53 1 ELI_04755 Light-activated DNA-binding protein EL222 Erythrobacter litoralis (strain HTCC2594)
P0AF31 0.000207 44 31 3 129 3 narL Nitrate/nitrite response regulator protein NarL Shigella flexneri
P0AF28 0.000207 44 31 3 129 1 narL Nitrate/nitrite response regulator protein NarL Escherichia coli (strain K12)
P0AF29 0.000207 44 31 3 129 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AF30 0.000207 44 31 3 129 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O157:H7
P9WMF9 0.00024 43 25 4 196 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 0.00024 43 25 4 196 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q551X9 0.000243 45 26 2 119 3 dhkF Hybrid signal transduction histidine kinase F Dictyostelium discoideum
A0A4P7TS68 0.000257 44 23 0 110 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 0.000257 44 23 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 0.000257 44 23 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 0.000257 44 23 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 0.000257 44 23 0 110 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 0.000257 44 23 0 110 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 0.000257 44 23 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 0.000257 44 23 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P39663 0.000265 44 26 4 164 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q46791 0.000267 43 38 0 52 1 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli (strain K12)
Q5HLK6 0.000271 43 38 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L481 0.000288 43 33 3 109 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q8CN75 0.000306 43 38 0 55 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q82EB1 0.000322 43 30 1 100 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9KL96 0.000324 43 28 5 163 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P21866 0.000334 43 29 2 124 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q9ZEP4 0.000356 43 30 1 100 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P31802 0.000378 43 27 2 143 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P0AE90 0.000406 43 31 5 158 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 0.000406 43 31 5 158 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 0.000406 43 31 5 158 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P96602 0.000421 43 29 0 79 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P24908 0.000423 43 25 4 198 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6GK51 0.000423 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q8NYH3 0.000439 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 0.000439 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
P60610 0.000439 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 0.000439 43 21 2 119 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 0.000439 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 0.000439 43 21 2 119 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 0.000439 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q7D9K0 0.000451 43 30 0 110 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 0.000451 43 30 0 110 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B8GZM2 0.000464 43 33 3 106 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 0.000464 43 33 3 106 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2YV67 0.000465 43 21 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
O07528 0.000486 43 22 2 145 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P52942 0.00056 41 29 0 72 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
P48027 0.000673 43 26 1 113 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P58664 0.00068 42 38 0 52 4 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli O157:H7
A0A0H3GGB5 0.000695 42 32 5 158 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P40138 0.000701 43 27 3 138 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P08368 0.000789 42 23 0 104 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P0AEF7 0.0008 42 33 0 69 3 dpiA Transcriptional regulatory protein DpiA Shigella flexneri
P0AEF4 0.0008 42 33 0 69 1 dpiA Transcriptional regulatory protein DpiA Escherichia coli (strain K12)
P0AEF5 0.0008 42 33 0 69 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEF6 0.0008 42 33 0 69 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O157:H7
O32197 0.000835 42 23 3 145 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
O34951 0.000859 42 28 2 114 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P45189 0.000867 42 28 3 121 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45605 0.001 42 23 1 142 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P06628 0.001 41 29 0 68 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06900
Feature type CDS
Gene ttrR
Product tetrathionate respiration response regulator TtrR
Location 1430643 - 1431254 (strand: 1)
Length 612 (nucleotides) / 203 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_496
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00196 Bacterial regulatory proteins, luxR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4566 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, FixJ family, consists of REC and HTH domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13041 two-component system, LuxR family, response regulator TtrR Two-component system -

Protein Sequence

MPVIHLVDDDIAVTQACQFLLESLGYDVSIWNDSRTFIAQAPLHTYGIVLLDMRMPDPDGCRVHQLLREQHSTLAVIFLTGHGDLPMAVGQMKLGAVDFLQKPVATQPLQAALTRAAAVTEKAVADRAIHGRFLTLTPKERQIAGFVAQGLMNREIADVAHVAVRTVEVHRAKVMEKMAAGSLAELVTQLNTINAGDSCVTEN

Flanking regions ( +/- flanking 50bp)

TCCGGCTTATGTGTTACCCTTATCTTTACCCGACTGACAGAGGAGCCACCATGCCCGTAATTCACCTGGTTGATGATGACATCGCCGTGACACAGGCGTGTCAGTTTTTACTGGAAAGCCTCGGCTATGATGTCAGTATCTGGAATGACAGCCGGACATTTATTGCACAGGCACCACTGCATACTTACGGTATTGTATTACTGGACATGCGGATGCCGGACCCTGATGGTTGCCGGGTTCATCAGCTACTCCGTGAGCAGCACAGTACGCTGGCGGTTATCTTTCTGACCGGACACGGCGACCTGCCGATGGCGGTCGGACAAATGAAACTGGGTGCAGTGGATTTTCTGCAAAAACCGGTGGCCACACAGCCGTTACAGGCGGCGCTGACACGCGCCGCAGCCGTCACGGAAAAAGCTGTGGCTGACAGAGCAATCCACGGACGCTTCCTGACCCTGACCCCGAAAGAGCGCCAGATTGCCGGATTTGTGGCTCAGGGGCTGATGAACCGCGAAATCGCTGATGTCGCGCATGTTGCTGTGCGGACGGTAGAAGTTCACCGCGCAAAGGTGATGGAAAAAATGGCAGCCGGCAGCCTCGCAGAACTGGTGACACAACTGAATACTATCAATGCCGGTGATAGTTGCGTGACAGAAAACTGATATTACCGGAAAATACGACGTATAATTTATTATTATATCATTTACCTGCA