Homologs in group_572

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00905 FBDBKF_00905 100.0 Morganella morganii S1 ttrR tetrathionate respiration response regulator TtrR
EHELCC_00640 EHELCC_00640 100.0 Morganella morganii S2 ttrR tetrathionate respiration response regulator TtrR
NLDBIP_02820 NLDBIP_02820 100.0 Morganella morganii S4 ttrR tetrathionate respiration response regulator TtrR
LHKJJB_04335 LHKJJB_04335 100.0 Morganella morganii S3 ttrR tetrathionate respiration response regulator TtrR
F4V73_RS06900 F4V73_RS06900 86.2 Morganella psychrotolerans ttrR tetrathionate respiration response regulator TtrR
PMI_RS08245 PMI_RS08245 61.3 Proteus mirabilis HI4320 ttrR tetrathionate respiration response regulator TtrR

Distribution of the homologs in the orthogroup group_572

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_572

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQM8 5.4e-83 248 62 0 198 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23221 1.12e-45 152 42 2 188 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P10958 2.41e-38 134 40 1 188 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P26487 4.58e-37 131 39 4 204 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q3LWR6 6.12e-36 128 33 1 198 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 6.12e-36 128 33 1 198 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 6.12e-36 128 33 1 198 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8KR08 7.58e-35 125 33 1 198 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P15940 9.59e-33 120 33 1 204 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P37740 2.32e-30 113 36 3 189 3 dctR C4-dicarboxylate transport transcriptional regulatory protein DctR Rhodobacter capsulatus
O87940 3.53e-26 103 32 2 190 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
P10046 1.55e-18 85 39 1 117 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q9HU19 3.85e-18 85 39 0 114 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDE4 2.74e-16 77 25 3 182 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P13632 3.88e-15 76 36 0 115 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P72781 2.03e-14 72 27 4 213 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P14375 3.34e-13 70 34 0 117 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8X613 3.37e-13 70 34 0 117 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P0AGA9 7.36e-12 64 31 7 201 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 7.36e-12 64 31 7 201 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 7.36e-12 64 31 7 201 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 7.36e-12 64 31 7 201 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
Q9APD9 1.91e-11 65 31 0 117 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P96686 3.37e-11 63 26 5 212 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P27667 6.31e-11 62 31 7 197 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 1.51e-10 63 32 0 117 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 1.52e-10 62 32 0 117 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7CQM5 1.76e-10 61 25 2 152 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P48359 4.19e-10 60 24 7 207 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P48259 6.04e-10 60 31 1 110 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P06184 6.07e-10 61 39 1 86 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P41789 1.03e-09 60 30 0 101 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87MX7 1.18e-09 60 28 0 111 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0C5S5 1.26e-09 60 28 0 111 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.26e-09 60 28 0 111 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q07783 1.72e-09 58 29 2 134 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P45337 1.8e-09 58 32 0 110 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P28787 3.02e-09 59 42 0 69 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
O25918 3.92e-09 57 24 4 156 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q7MM78 4.42e-09 58 28 0 111 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 4.42e-09 58 28 0 111 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q04849 4.73e-09 58 25 2 135 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
O34903 4.83e-09 57 31 1 114 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q1M7A0 4.98e-09 57 25 2 147 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0C5S3 6.05e-09 57 29 0 108 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
O25408 6.42e-09 58 25 3 117 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
P0AFB8 7.53e-09 58 29 0 101 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 7.53e-09 58 29 0 101 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P50350 7.55e-09 57 32 1 109 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
A6UEL7 8.68e-09 56 29 0 108 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
Q9HWA4 9.22e-09 57 33 4 118 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O78428 9.58e-09 57 27 2 144 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P0A4H2 1.19e-08 56 26 5 199 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 1.19e-08 56 26 5 199 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 1.19e-08 56 26 5 199 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P03029 1.38e-08 57 29 0 101 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P50351 1.48e-08 56 32 3 113 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9KT84 1.68e-08 57 27 0 111 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P13792 1.9e-08 56 26 1 124 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q7A0U4 2.13e-08 55 24 6 207 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 2.13e-08 55 24 6 207 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 2.13e-08 55 24 6 207 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 2.13e-08 55 24 6 207 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 2.13e-08 55 24 6 207 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 2.13e-08 55 24 6 207 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 2.13e-08 55 24 6 207 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 2.13e-08 55 24 6 207 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8FZ93 2.35e-08 55 25 2 143 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 2.35e-08 55 25 2 143 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 2.35e-08 55 25 2 143 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 2.35e-08 55 25 2 143 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 2.35e-08 55 25 2 143 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 2.35e-08 55 25 2 143 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 2.35e-08 55 25 2 143 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 2.35e-08 55 25 2 143 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q92HC2 3.17e-08 56 28 3 120 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P28257 3.45e-08 55 30 3 114 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q47456 3.72e-08 55 30 0 103 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q1RJS1 3.8e-08 55 27 3 120 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
A6WZ81 4.12e-08 55 26 1 123 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9ZCY9 5.9e-08 55 27 3 120 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
P0A4H8 6.64e-08 54 23 4 217 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 6.64e-08 54 23 4 217 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q06065 7.39e-08 55 28 2 118 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P0AEL8 7.71e-08 53 24 2 150 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 7.71e-08 53 24 2 150 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
P23747 7.74e-08 55 30 0 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UL27 8.12e-08 55 27 3 120 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B8H358 1e-07 53 26 1 123 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1e-07 53 26 1 123 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A1TEL7 1.01e-07 53 33 1 114 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8DPL7 1.08e-07 53 27 1 111 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.08e-07 53 27 1 111 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.08e-07 53 27 1 111 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P51343 1.09e-07 53 24 4 185 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q68WH4 1.15e-07 54 27 3 120 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q00934 1.19e-07 54 24 2 147 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P26275 1.46e-07 53 44 1 70 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88AQ2 1.55e-07 54 26 1 139 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88RJ6 1.55e-07 54 26 1 139 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P28835 1.68e-07 53 27 1 120 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P0AED6 2.43e-07 52 25 2 143 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 2.43e-07 52 25 2 143 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P66797 2.43e-07 52 25 2 143 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 2.43e-07 52 25 2 143 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q1XDC9 2.63e-07 52 29 4 125 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P66795 2.73e-07 52 29 2 138 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 2.73e-07 52 29 2 138 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q9I4N3 2.75e-07 53 28 0 106 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P51358 3.1e-07 52 29 4 125 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P42508 3.17e-07 52 29 2 110 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
P9WMF9 3.63e-07 52 24 1 154 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 3.63e-07 52 24 1 154 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q53228 3.98e-07 51 32 2 100 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9TLQ4 4.06e-07 52 29 1 108 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P94413 4.48e-07 52 23 5 215 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q8CQ37 4.87e-07 52 34 4 114 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 4.87e-07 52 34 4 114 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9K621 5.04e-07 52 29 3 129 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q49XM7 5.09e-07 51 28 2 114 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O82868 5.68e-07 51 29 2 114 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q9CD68 6.22e-07 51 29 1 143 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P35163 8.38e-07 51 23 6 207 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q9AE24 9.07e-07 51 21 4 212 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q6GE42 1.34e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q2YZ42 1.34e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1B3X8 1.36e-06 50 30 3 148 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.36e-06 50 30 3 148 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.36e-06 50 30 3 148 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q49VK3 1.5e-06 50 31 3 111 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0AFU5 1.54e-06 51 31 0 111 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 1.54e-06 51 31 0 111 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q7A029 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 1.69e-06 50 38 0 62 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1KHB7 2.02e-06 50 28 1 142 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 2.02e-06 50 28 1 142 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P38889 2.07e-06 50 28 0 110 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P26319 2.35e-06 49 22 3 172 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KL96 2.43e-06 50 28 4 165 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0DMK7 2.92e-06 49 32 3 101 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 2.92e-06 49 32 3 101 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q8XBS3 3.19e-06 49 29 0 102 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P52076 3.26e-06 49 29 0 102 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q7WZY4 3.67e-06 49 39 0 58 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
A8Z181 3.83e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 3.83e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 3.83e-06 49 34 6 118 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 3.83e-06 49 34 6 118 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 3.83e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
P0A4I0 3.91e-06 49 29 1 119 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 3.91e-06 49 29 1 119 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q7A1L2 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
Q2YSS2 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IQL2 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 3.94e-06 49 34 6 118 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P9WGM9 4.03e-06 49 28 1 142 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 4.03e-06 49 28 1 142 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 4.03e-06 49 28 1 142 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q5A4X5 4.1e-06 50 28 1 116 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6GJ11 4.26e-06 49 33 4 114 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q932F1 4.43e-06 49 34 6 118 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A0I0 4.6e-06 48 21 3 142 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 4.6e-06 48 21 3 142 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 4.6e-06 48 21 3 142 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 4.6e-06 48 21 3 142 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 4.6e-06 48 21 3 142 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 4.6e-06 48 21 3 142 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P14204 4.79e-06 48 23 5 206 1 comA Transcriptional regulatory protein ComA Bacillus subtilis (strain 168)
Q46791 4.9e-06 48 35 1 65 1 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli (strain K12)
Q44006 5.73e-06 48 30 1 110 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q4UU85 6.14e-06 49 27 2 112 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q55890 6.39e-06 48 28 3 152 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P45365 7.34e-06 49 23 3 160 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
A0R3I8 7.75e-06 48 30 0 110 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9F868 1.02e-05 48 29 1 113 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8CN75 1.03e-05 48 24 3 163 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0CL17 1.24e-05 47 31 3 111 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1.24e-05 47 31 3 111 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
L7N689 1.25e-05 48 27 0 108 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q31S42 1.34e-05 47 32 1 112 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0PWB4 1.37e-05 47 30 0 110 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q742C1 1.37e-05 47 30 0 110 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.37e-05 47 30 0 110 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P58664 1.52e-05 47 35 1 65 4 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli O157:H7
P48027 1.62e-05 48 30 3 116 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
P0ACZ7 1.66e-05 47 22 3 158 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 1.66e-05 47 22 3 158 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 1.66e-05 47 22 3 158 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 1.66e-05 47 22 3 158 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
B8GZM2 1.71e-05 48 33 3 106 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 1.71e-05 48 33 3 106 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5HLK6 1.83e-05 47 24 3 163 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C001 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.92e-05 47 25 1 113 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.92e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q4L8Q6 1.93e-05 47 24 3 162 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
Q99U73 2.06e-05 47 25 1 113 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P24908 2.09e-05 47 25 5 198 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37478 2.51e-05 47 28 1 108 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
O49397 2.66e-05 47 30 2 106 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q9ZHD3 2.71e-05 47 28 0 108 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q9I0I1 2.75e-05 47 27 1 122 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4A160 2.92e-05 47 31 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P9WGL9 2.93e-05 46 29 1 113 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 2.93e-05 46 29 1 113 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 2.93e-05 46 29 1 113 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P36556 3.13e-05 46 26 7 200 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8CQK0 3.19e-05 46 28 2 126 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 3.19e-05 46 28 2 126 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0AEC5 3.23e-05 47 30 4 122 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 3.23e-05 47 30 4 122 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 3.23e-05 47 30 4 122 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q95PI2 3.57e-05 47 29 2 120 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q02540 3.87e-05 46 36 0 74 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q9F8D7 4e-05 47 30 4 116 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q7A216 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 4.04e-05 46 29 3 134 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 4.04e-05 46 29 3 134 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 4.04e-05 46 29 3 134 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 4.04e-05 46 29 3 134 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P52942 4.13e-05 45 30 0 72 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
P76340 4.79e-05 46 27 4 159 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
A8R3S7 4.88e-05 46 26 5 201 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
P44918 6.12e-05 45 26 1 108 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q52990 6.29e-05 45 24 7 216 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P0A9Q4 6.48e-05 45 25 1 108 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 6.48e-05 45 25 1 108 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 6.48e-05 45 25 1 108 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 6.48e-05 45 25 1 108 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P32040 7.21e-05 45 26 1 115 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P06628 7.49e-05 44 26 2 120 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q2NB98 7.89e-05 45 38 0 55 1 ELI_04755 Light-activated DNA-binding protein EL222 Erythrobacter litoralis (strain HTCC2594)
Q4L481 7.99e-05 45 32 5 113 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
P0ACZ8 9.47e-05 45 32 1 78 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 9.47e-05 45 32 1 78 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 9.47e-05 45 32 1 78 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P44895 9.56e-05 45 31 3 132 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O05251 9.69e-05 45 31 1 80 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P42244 9.78e-05 45 23 2 128 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P30843 0.000102 45 27 0 108 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q54YZ9 0.000109 45 26 2 115 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q7A1J1 0.00011 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 0.00011 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 0.00011 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 0.00011 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 0.00011 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 0.00011 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 0.00011 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 0.00011 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 0.00011 45 25 1 104 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 0.00011 45 25 1 104 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P59342 0.000111 45 29 4 122 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
Q44929 0.000111 45 25 6 148 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
O07528 0.000123 45 22 2 145 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q9ZEP4 0.000136 45 30 3 104 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82EB1 0.000151 44 27 2 122 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P39663 0.000157 44 25 4 164 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9K998 0.000162 44 26 4 133 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q4LAJ9 0.000176 44 30 1 106 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P9WGM5 0.000178 44 26 4 159 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 0.000178 44 26 4 159 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P40138 0.000187 45 29 4 140 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P23620 0.000191 44 25 1 128 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P31079 0.000229 44 24 5 153 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P62640 0.000247 44 29 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8NYH3 0.000285 43 22 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 0.000285 43 22 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
P70955 0.00029 43 32 1 68 1 natR Transcriptional regulatory protein NatR Bacillus subtilis (strain 168)
P94439 0.000296 43 23 3 152 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q6GK51 0.000296 43 22 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
P60610 0.000304 43 22 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 0.000304 43 22 2 119 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 0.000304 43 22 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 0.000304 43 22 2 119 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 0.000304 43 22 2 119 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q2YV67 0.000313 43 22 2 125 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L6C6 0.000326 43 23 1 113 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P31802 0.000378 43 25 5 189 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P0AF31 0.000434 43 31 4 129 3 narL Nitrate/nitrite response regulator protein NarL Shigella flexneri
P0AF28 0.000434 43 31 4 129 1 narL Nitrate/nitrite response regulator protein NarL Escherichia coli (strain K12)
P0AF29 0.000434 43 31 4 129 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AF30 0.000434 43 31 4 129 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O157:H7
Q87K77 0.00047 43 27 7 161 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q23917 0.0005 43 27 4 116 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
Q8GP20 0.000529 43 29 5 128 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q51373 0.000581 42 23 2 153 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7D9K0 0.000586 43 30 0 110 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 0.000586 43 30 0 110 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P45605 0.000618 42 25 1 112 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P9WGM7 0.0008 42 27 1 100 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 0.0008 42 27 1 100 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 0.0008 42 27 1 100 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 0.000812 42 27 1 100 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q56127 0.000835 42 22 6 186 3 rcsB Transcriptional regulatory protein RcsB Salmonella typhi
P0A4H5 0.00084 41 34 0 70 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 0.00084 41 34 0 70 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P0AEF7 0.000847 42 33 0 69 3 dpiA Transcriptional regulatory protein DpiA Shigella flexneri
P0AEF4 0.000847 42 33 0 69 1 dpiA Transcriptional regulatory protein DpiA Escherichia coli (strain K12)
P0AEF5 0.000847 42 33 0 69 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEF6 0.000847 42 33 0 69 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O157:H7
P55184 0.000868 42 25 3 164 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
Q9CCJ2 0.000875 42 27 1 100 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P69410 0.000892 42 22 6 186 3 rcsB Transcriptional regulatory protein RcsB Shigella flexneri
P0DMC8 0.000892 42 22 6 186 1 rcsB Transcriptional regulatory protein RcsB Escherichia coli
P0DMC7 0.000892 42 22 6 186 1 rcsB Transcriptional regulatory protein RcsB Escherichia coli (strain K12)
P69408 0.000892 42 22 6 186 3 rcsB Transcriptional regulatory protein RcsB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69409 0.000892 42 22 6 186 3 rcsB Transcriptional regulatory protein RcsB Escherichia coli O157:H7
P58663 0.001 42 22 6 186 1 rcsB Transcriptional regulatory protein RcsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P59969 0.001 43 31 3 104 4 BQ2027_MB0914C Putative HTH-type transcriptional regulator Mb0914c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG0 0.001 43 31 3 104 4 MT0914 Putative HTH-type transcriptional regulator MT0914 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q01473 0.001 43 26 0 100 3 rcaC Protein RcaC Microchaete diplosiphon
A0A4P7TS68 0.001 42 22 0 110 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 0.001 42 22 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 0.001 42 22 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 0.001 42 22 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 0.001 42 22 0 110 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 0.001 42 22 0 110 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 0.001 42 22 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 0.001 42 22 0 110 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
O34951 0.001 42 28 3 117 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02710
Feature type CDS
Gene ttrR
Product tetrathionate respiration response regulator TtrR
Location 143560 - 144171 (strand: -1)
Length 612 (nucleotides) / 203 (amino acids)
In genomic island -

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_572
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00196 Bacterial regulatory proteins, luxR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4566 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, FixJ family, consists of REC and HTH domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13041 two-component system, LuxR family, response regulator TtrR Two-component system -

Protein Sequence

MPVIHLVDDDVAVTQACQFLLESLGYEVCVWNDSRTFVAQAPLHTYGIVLLDMRMPHFDGCRVHQILQEQHSTLAVIFLTGHGDLPMAVEQMKLGAVDFLQKPVATQPLQAALTRAAAVTGKAVACAQIRDRFQTLTPKERQIAGFVAQGLMNREIADIAHVAVRTVEVHRAKVMEKMAAGSLAELVTQLNSITDAENSTAEH

Flanking regions ( +/- flanking 50bp)

CCCGGCTTATGTGTTACCCTTATCTTCAGTGAACCGACAAAGGAATCCCCATGCCCGTGATCCACCTGGTTGATGATGATGTTGCAGTGACACAGGCGTGTCAGTTTTTACTGGAGAGCCTCGGTTATGAGGTGTGTGTCTGGAATGACAGCCGGACATTTGTTGCACAGGCGCCGCTGCACACTTACGGTATTGTGTTACTGGATATGCGCATGCCGCATTTTGACGGCTGCCGTGTGCATCAGATCCTTCAGGAGCAGCACAGCACACTGGCAGTGATATTCCTGACCGGCCACGGCGACCTGCCGATGGCGGTTGAGCAGATGAAACTCGGTGCGGTGGATTTTCTGCAGAAACCGGTGGCCACACAACCGTTGCAGGCAGCACTGACCCGCGCCGCCGCTGTAACCGGTAAAGCTGTGGCCTGTGCCCAAATTCGTGACCGTTTTCAGACTCTGACGCCGAAAGAGCGTCAGATCGCCGGTTTTGTCGCACAAGGACTGATGAACCGGGAAATCGCTGATATTGCCCATGTTGCGGTAAGAACCGTCGAAGTGCACCGCGCCAAAGTGATGGAAAAAATGGCGGCGGGCAGCCTCGCGGAGCTGGTCACGCAGCTCAACAGCATTACGGACGCTGAAAACAGCACCGCAGAGCACTAACATCTGCAACCGATACCACGTATAATTTAGTGTTATATCATTTACATGAA