Homologs in group_961

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05285 FBDBKF_05285 94.7 Morganella morganii S1 oppC oligopeptide ABC transporter permease OppC
EHELCC_12305 EHELCC_12305 94.7 Morganella morganii S2 oppC oligopeptide ABC transporter permease OppC
NLDBIP_12645 NLDBIP_12645 94.7 Morganella morganii S4 oppC oligopeptide ABC transporter permease OppC
LHKJJB_12505 LHKJJB_12505 94.7 Morganella morganii S3 oppC oligopeptide ABC transporter permease OppC
HKOGLL_11120 HKOGLL_11120 94.7 Morganella morganii S5 oppC oligopeptide ABC transporter permease OppC
PMI_RS07130 PMI_RS07130 85.8 Proteus mirabilis HI4320 oppC oligopeptide ABC transporter permease OppC

Distribution of the homologs in the orthogroup group_961

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_961

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08006 1.62e-174 487 82 0 302 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFH6 2.25e-169 474 83 0 302 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 2.25e-169 474 83 0 302 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P45053 1.33e-154 437 71 1 302 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24139 8.07e-87 265 43 2 303 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
P42063 1.24e-71 226 40 3 291 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
P26904 1.96e-71 226 43 2 276 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P94312 6.13e-62 201 38 1 277 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q83S25 6.89e-61 198 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 6.89e-61 198 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
Q8FJK8 9.94e-61 198 36 2 298 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 9.94e-61 198 36 2 298 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FWN9 1.08e-60 198 37 2 276 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
Q3Z3V1 2.54e-60 197 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 2.54e-60 197 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 2.54e-60 197 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
P75799 4.3e-60 196 37 2 279 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
A5VU89 5.91e-60 196 36 2 276 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q1RE93 7.7e-60 196 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 7.7e-60 196 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q8YBN8 1.03e-59 195 36 2 276 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 1.03e-59 195 36 2 276 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 1.03e-59 195 36 2 276 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q32IB8 1.4e-58 192 36 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q6D3B2 8.78e-58 190 34 2 298 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P66965 2.77e-57 189 40 4 276 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 2.77e-57 189 40 4 276 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 2.77e-57 189 40 4 276 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7CQV4 9.99e-55 182 38 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 9.99e-55 182 38 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 9.99e-55 182 38 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 9.99e-55 182 38 3 257 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
A2RI76 5.76e-52 177 38 5 313 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
P77463 2.32e-51 174 36 1 261 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
Q8YDG8 1.28e-42 151 33 2 244 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 1.28e-42 151 33 2 244 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 1.28e-42 151 33 2 244 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
Q2YXY8 1.54e-42 150 34 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8FUW9 1.88e-42 150 33 2 244 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
Q7A0Y0 2.35e-42 150 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 2.35e-42 150 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 2.35e-42 150 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 2.35e-42 150 33 0 216 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 2.35e-42 150 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q7A5Q7 4.36e-42 149 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 4.36e-42 149 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0A4N0 2.9e-41 148 28 3 292 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 2.9e-41 148 28 3 292 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6GH26 1.01e-40 145 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
P51000 2.33e-40 145 29 1 272 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2ZFV0 2.44e-40 145 29 1 274 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q53192 4.93e-40 144 35 2 221 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AFA9 9.73e-38 138 32 1 226 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 9.73e-38 138 32 1 226 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
Q2FVE9 2.4e-36 134 30 1 270 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JU73 3.03e-36 134 30 1 270 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0AEG1 1.01e-35 133 32 1 272 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 1.01e-35 133 32 1 272 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 1.01e-35 133 32 1 272 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
P33915 2.15e-35 133 33 2 227 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P0A4P0 2.8e-35 132 27 4 291 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 2.55e-34 129 27 4 291 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
Q7D203 5.5e-32 125 29 2 231 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A2J5 2.21e-28 114 28 2 273 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 2.21e-28 114 28 2 273 3 sapC Peptide transport system permease protein SapC Salmonella typhi
P0AGH7 7.5e-27 109 27 2 273 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 7.5e-27 109 27 2 273 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 7.5e-27 109 27 2 273 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P47324 6.6e-21 94 30 12 304 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75553 2.03e-18 87 30 10 255 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P45287 1.66e-17 84 23 5 277 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFH5 0.000595 44 30 5 140 3 oppB Oligopeptide transport system permease protein OppB Shigella flexneri
P0AFH2 0.000595 44 30 5 140 1 oppB Oligopeptide transport system permease protein OppB Escherichia coli (strain K12)
P0AFH3 0.000595 44 30 5 140 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFH4 0.000595 44 30 5 140 3 oppB Oligopeptide transport system permease protein OppB Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05740
Feature type CDS
Gene oppC
Product oligopeptide ABC transporter permease OppC
Location 1218421 - 1219329 (strand: -1)
Length 909 (nucleotides) / 302 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_961
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15582 oligopeptide transport system permease protein beta-Lactam resistance
ABC transporters
Quorum sensing
-

Protein Sequence

MLPNEKKCDALANFAEQQNVEGRSLWADARRRFIHNKAAITSLCLLSLITLFVIFAPVLSDFAYDDTDWEMMSASPDSETGHYFGTDSSGRDLLVRVAIGGRISLMVGLAAALVAVLVGTLYGAMSGYVGGKTDSVMMRVLEILNSFPFMFFVILLVTFFGQNIFLIFVAIGMVSWLDMARIVRGQTLSLKSKEFIEAAKVCGVPTRNIILRHIVPNVLGVVVVYASLLVPSMILFESFLSFLGLGTQEPLSSWGALLNDGANSMEVSPWLLMFPAAFLVVTLFCFNFIGDGLRDALDPKDR

Flanking regions ( +/- flanking 50bp)

CTGTATGCCGTTATCGATCCGAAAATCCGCTATTAACTCAGGAGCACGCTATGTTACCGAATGAAAAAAAATGCGACGCTCTGGCGAATTTTGCGGAGCAGCAAAATGTTGAAGGGCGCAGTTTATGGGCGGATGCCCGTCGTCGTTTTATACACAATAAAGCGGCGATCACCAGCCTGTGTCTCCTGTCTTTAATTACACTGTTTGTTATTTTTGCGCCGGTGTTATCGGATTTTGCTTACGATGATACAGACTGGGAAATGATGTCTGCGTCACCGGACAGCGAAACCGGGCACTATTTCGGCACGGACTCCTCCGGGCGTGACCTGCTGGTGCGTGTGGCAATCGGCGGGCGTATTTCGCTGATGGTCGGTCTGGCGGCAGCGCTGGTGGCGGTGCTGGTGGGAACACTCTACGGCGCAATGTCCGGATATGTCGGCGGTAAAACAGACTCCGTGATGATGCGCGTACTGGAAATTCTCAACTCCTTCCCGTTTATGTTTTTTGTTATCTTACTCGTCACCTTCTTCGGGCAGAATATCTTCCTGATCTTTGTGGCCATCGGGATGGTGTCCTGGCTGGATATGGCGCGTATTGTGCGCGGACAAACCCTCAGCCTGAAGAGCAAAGAGTTTATTGAAGCCGCGAAAGTCTGTGGTGTGCCGACCCGCAATATTATTCTGCGCCATATAGTGCCGAATGTGCTGGGTGTGGTGGTGGTGTATGCCTCACTGCTGGTGCCGAGCATGATCCTGTTTGAATCCTTCCTCAGTTTCCTGGGGCTGGGAACACAGGAGCCGTTAAGCAGCTGGGGTGCATTGCTTAATGATGGCGCAAACTCCATGGAAGTATCGCCCTGGTTACTGATGTTCCCGGCAGCATTCCTGGTGGTGACTCTGTTTTGTTTTAACTTTATCGGCGATGGGTTGCGTGATGCCCTTGACCCGAAAGATCGCTGAGGAGGCCGCCAATGACTCAGTTATTACAGGTAAAAGACCTGAATGTGGCG