Homologs in group_961

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05285 FBDBKF_05285 87.7 Morganella morganii S1 oppC oligopeptide ABC transporter permease OppC
EHELCC_12305 EHELCC_12305 87.7 Morganella morganii S2 oppC oligopeptide ABC transporter permease OppC
NLDBIP_12645 NLDBIP_12645 87.7 Morganella morganii S4 oppC oligopeptide ABC transporter permease OppC
LHKJJB_12505 LHKJJB_12505 87.7 Morganella morganii S3 oppC oligopeptide ABC transporter permease OppC
HKOGLL_11120 HKOGLL_11120 87.7 Morganella morganii S5 oppC oligopeptide ABC transporter permease OppC
F4V73_RS05740 F4V73_RS05740 85.8 Morganella psychrotolerans oppC oligopeptide ABC transporter permease OppC

Distribution of the homologs in the orthogroup group_961

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_961

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08006 0.0 506 86 0 302 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFH6 7.01e-173 483 86 0 302 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 7.01e-173 483 86 0 302 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P45053 1.89e-153 434 71 0 294 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P24139 8.36e-86 262 43 1 300 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
P26904 2.23e-74 234 41 3 303 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
P42063 1.9e-72 228 40 3 291 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
Q83S25 9.51e-63 203 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 9.51e-63 203 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
P94312 3.65e-62 202 38 1 277 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q3Z3V1 4.64e-62 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 4.64e-62 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 4.64e-62 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
Q8FJK8 5.23e-62 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 5.23e-62 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75799 7.97e-62 201 37 2 279 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q1RE93 1.12e-61 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 1.12e-61 201 37 2 279 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q32IB8 5.55e-61 199 36 2 279 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
Q8FWN9 4.43e-59 194 38 2 271 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
P66965 5.25e-59 193 40 3 275 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 5.25e-59 193 40 3 275 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 5.25e-59 193 40 3 275 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5VU89 2.54e-58 192 37 2 271 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 3.86e-58 191 37 2 271 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 3.86e-58 191 37 2 271 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 3.86e-58 191 37 2 271 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
Q6D3B2 4.09e-58 191 35 2 283 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7CQV4 1.85e-57 189 39 2 256 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 1.85e-57 189 39 2 256 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 1.85e-57 189 39 2 256 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 1.85e-57 189 39 2 256 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
P77463 9.1e-53 177 36 1 261 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
A2RI76 1.04e-51 176 35 3 321 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
Q8YDG8 1.06e-43 154 34 2 270 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 1.06e-43 154 34 2 270 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 1.06e-43 154 34 2 270 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
A0A0H2ZFV0 3.55e-43 152 30 3 282 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8FUW9 4.06e-43 152 34 2 236 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
P51000 7.26e-43 152 30 1 272 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4N0 1.31e-42 151 30 3 292 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 1.31e-42 151 30 3 292 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q2YXY8 2.44e-40 144 33 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A0Y0 5.08e-40 144 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 5.08e-40 144 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 5.08e-40 144 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 5.08e-40 144 32 0 216 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 5.08e-40 144 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q53192 7.14e-40 144 32 3 242 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7A5Q7 7.52e-40 143 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 7.52e-40 143 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0AEG1 2.51e-39 142 34 1 278 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 2.51e-39 142 34 1 278 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 2.51e-39 142 34 1 278 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
Q6GH26 9.02e-39 140 32 0 216 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
P0AFA9 7.92e-37 135 32 1 227 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 7.92e-37 135 32 1 227 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
Q2FVE9 5.33e-35 131 29 3 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JU73 5.5e-35 131 29 3 273 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
P33915 5.58e-34 129 33 4 229 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P0A4P0 1.38e-33 127 26 4 291 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 3.83e-33 126 26 4 291 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
Q7D203 5.74e-29 117 28 1 220 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A2J5 1.82e-27 111 27 1 275 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 1.82e-27 111 27 1 275 3 sapC Peptide transport system permease protein SapC Salmonella typhi
P0AGH7 5.86e-27 110 26 1 275 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 5.86e-27 110 26 1 275 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 5.86e-27 110 26 1 275 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45287 5.13e-21 94 24 3 276 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P47324 6.02e-18 86 30 10 255 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75553 4.02e-16 81 30 7 225 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07130
Feature type CDS
Gene oppC
Product oligopeptide ABC transporter permease OppC
Location 1556710 - 1557618 (strand: -1)
Length 909 (nucleotides) / 302 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_961
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15582 oligopeptide transport system permease protein beta-Lactam resistance
ABC transporters
Quorum sensing		 -

Protein Sequence

MLSMKENSEALGNFSEQLDVEGRSLWQDARRRFMHNKAAITSLVLLFCILLFVIFAPMLSPFVYDDTDWEMMSMPPDFASAHYFGTDSSGRDLLVRVAIGGRISLMVGIAAAFVAVIVGTLYGAMAGYIGGRVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMARIVRGQTLSLKRKEFIEAALVCGVSSRNIVLKHIVPNVLGVVVVYASLLVPSMILFESFLSFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLFPAAFLVVTLFCFNFIGDGLRDALDPKDR

Flanking regions ( +/- flanking 50bp)

ACGCCGTAATCGATCCGAAAATTCGTTATTAATAGAGACTGGAGCACGTTATGTTATCGATGAAAGAAAATAGCGAAGCTCTGGGGAATTTCTCGGAGCAGCTAGATGTTGAAGGTCGTAGTTTATGGCAAGATGCCCGTCGTCGTTTTATGCACAATAAAGCGGCGATCACCAGCCTAGTACTACTATTTTGTATTTTACTTTTTGTCATTTTCGCCCCCATGTTATCGCCTTTTGTTTATGACGATACGGATTGGGAAATGATGTCAATGCCACCTGATTTTGCCTCAGCGCACTATTTTGGCACTGACTCATCAGGACGTGACTTATTAGTTCGTGTAGCAATTGGTGGACGTATTTCACTGATGGTAGGTATTGCAGCGGCATTTGTCGCGGTGATTGTTGGCACCCTCTATGGCGCGATGGCAGGTTATATCGGTGGGCGCGTTGACTCAGTGATGATGCGTTTACTGGAGATATTAAACTCCTTCCCATTTATGTTCTTTGTTATCTTACTGGTGACCTTTTTTGGGCAAAATATCTTACTGATCTTTGTTGCCATCGGCATGGTATCTTGGCTCGATATGGCTCGTATCGTACGGGGACAAACACTTAGTTTAAAACGTAAAGAGTTTATTGAAGCGGCGTTAGTCTGTGGTGTGTCATCACGTAATATCGTCCTTAAACACATCGTGCCTAATGTATTAGGTGTTGTTGTGGTATACGCTTCATTACTGGTTCCTAGCATGATCTTATTTGAATCATTTTTAAGTTTCTTAGGATTAGGCACACAAGAGCCATTAAGTAGTTGGGGAGCACTACTGAGTGATGGTGCAAATTCAATGGAAGTTTCTCCTTGGTTATTACTTTTCCCAGCTGCATTTTTAGTTGTCACCTTGTTTTGCTTTAACTTTATCGGTGATGGTTTACGTGACGCGTTAGATCCGAAAGATCGTTAAGGAGAACATGATGACAAATTCAACAAATAAGCCATTGTTAAGTGTAAAAG