Homologs in group_688

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02845 FBDBKF_02845 85.4 Morganella morganii S1 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
EHELCC_03315 EHELCC_03315 85.4 Morganella morganii S2 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
NLDBIP_00145 NLDBIP_00145 85.4 Morganella morganii S4 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
LHKJJB_01890 LHKJJB_01890 85.4 Morganella morganii S3 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
HKOGLL_01930 HKOGLL_01930 85.4 Morganella morganii S5 fepC ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component
PMI_RS14635 PMI_RS14635 33.6 Proteus mirabilis HI4320 - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_688

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_688

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P07821 1.52e-47 161 34 3 229 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
P15031 1.24e-44 153 36 3 228 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
O34510 3.27e-44 152 34 5 248 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q81V82 1.56e-43 151 34 3 227 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
O32188 4.21e-43 150 33 3 227 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
P23878 2.59e-41 145 31 4 235 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
P94420 8.18e-40 140 31 6 245 1 yclP Petrobactin import ATP-binding protein YclP Bacillus subtilis (strain 168)
Q9HQ18 1.11e-39 144 34 7 259 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 1.11e-39 144 34 7 259 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q47087 6.51e-39 139 30 3 229 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
Q81LM1 6.33e-38 136 31 3 226 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
Q2RZ08 2.57e-37 135 32 6 234 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q32AY3 7.52e-37 133 32 6 232 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q8FCJ1 9.61e-37 133 32 6 232 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 9.61e-37 133 32 6 232 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1R597 1.31e-36 132 32 6 232 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
P49938 2.07e-36 132 30 3 228 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
O70014 2.59e-36 132 32 6 232 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q57554 3.74e-36 131 34 7 241 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8X5N2 4.52e-36 131 32 6 232 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q1I4Q5 1.76e-35 129 31 5 237 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas entomophila (strain L48)
Q3K6R9 1.57e-34 127 32 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain Pf0-1)
Q12R52 1.84e-34 127 32 7 232 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1LC89 2.58e-34 127 31 7 239 3 hmuV Hemin import ATP-binding protein HmuV Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7W025 3.16e-34 126 33 7 236 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q4K5Z7 5.69e-34 125 30 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q70GD4 9.33e-34 125 32 6 234 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q7WEH6 1.33e-33 125 32 7 236 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q659V4 1.55e-33 125 32 6 234 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q138A9 2.62e-33 124 32 6 234 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
Q2J3T0 4.23e-33 124 33 7 234 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain HaA2)
Q88DY1 9.33e-33 122 30 5 233 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q81XB3 2.13e-32 121 34 6 225 1 fatE Petrobactin import ATP-binding protein FatE Bacillus anthracis
Q7W359 4.71e-32 121 31 7 236 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7NN36 5.17e-32 121 31 5 234 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6LQC0 5.59e-32 121 30 4 225 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q93SH7 7.42e-32 120 29 6 239 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3ICT8 1.69e-31 119 31 6 232 3 hmuV Hemin import ATP-binding protein HmuV Pseudoalteromonas translucida (strain TAC 125)
Q8EB59 2.21e-31 119 31 7 245 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q92N13 2.43e-31 119 32 6 241 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
Q6N7Y6 2.59e-31 119 35 7 230 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O68877 3.56e-31 118 29 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FW7 3.56e-31 118 29 5 231 3 hmuV Hemin import ATP-binding protein HmuV Pseudomonas aeruginosa (strain UCBPP-PA14)
Q217B2 6.37e-31 118 30 5 245 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q31J97 8.61e-31 117 30 8 243 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q07LU3 1.18e-30 117 30 5 241 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q7N3S7 1.54e-30 117 30 8 261 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q28QF9 1.6e-30 117 30 6 246 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q3SQ65 1.89e-30 117 31 6 235 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8L1U3 4.01e-30 115 29 7 243 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 4.01e-30 115 29 7 243 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q47MA5 7.26e-30 115 34 5 228 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
Q7MFA1 1.35e-29 114 29 5 226 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain YJ016)
Q58283 2.12e-29 114 29 5 222 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q72AQ6 2.67e-29 114 31 6 231 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q3IM24 2.76e-29 114 34 8 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q8D3S8 3.65e-29 113 29 5 231 3 hmuV Hemin import ATP-binding protein HmuV Vibrio vulnificus (strain CMCP6)
Q5UW69 4.3e-29 113 32 6 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q2SB47 5.77e-29 112 28 5 235 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q2NSR0 1.17e-28 112 29 7 221 3 hmuV Hemin import ATP-binding protein HmuV Sodalis glossinidius (strain morsitans)
Q84EY8 1.47e-28 112 29 5 230 3 hmuV Hemin import ATP-binding protein HmuV Enterobacter cloacae
Q1DCP5 1.47e-28 112 28 6 239 3 hmuV Hemin import ATP-binding protein HmuV Myxococcus xanthus (strain DK1622)
Q0SIB7 2.79e-28 112 33 6 223 3 hmuV Hemin import ATP-binding protein HmuV Rhodococcus jostii (strain RHA1)
Q6D645 3.31e-28 111 29 6 230 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O34631 3.47e-28 114 33 5 229 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q2IYS5 4.97e-28 110 29 6 230 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q8UCM5 5.89e-28 110 30 5 230 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5E5I1 7.5e-28 110 30 5 226 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q66FK0 1.13e-27 109 27 7 250 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 1.13e-27 109 27 7 250 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 1.13e-27 109 27 7 250 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 1.13e-27 109 27 7 250 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q1J255 1.47e-27 109 29 6 251 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q160G4 2.02e-27 108 31 7 250 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q6WB63 2.43e-27 108 28 7 251 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
P74981 3.99e-27 108 28 6 234 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q89C51 4.48e-27 108 32 6 214 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1GJU0 4.63e-27 107 29 5 244 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q2T3B8 8.38e-27 107 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q93SS1 8.87e-27 107 26 4 243 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q7M8M4 1.28e-26 107 28 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6G475 1.39e-26 106 30 6 248 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q07PZ0 1.46e-26 107 29 6 230 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q87J32 2.46e-26 105 27 4 226 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9RKQ4 3.04e-26 106 29 5 234 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5QXD0 3.98e-26 105 28 5 236 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6G098 6.7e-26 105 29 6 246 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q20Y31 7.24e-26 105 31 5 216 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
Q1MCZ1 1.14e-25 104 28 5 244 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q70YG7 1.4e-25 103 28 9 240 1 hmuV Hemin import ATP-binding protein HmuV Vibrio anguillarum (strain ATCC 68554 / 775)
Q1R0Z6 2.61e-25 103 29 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2FNX9 5e-25 102 30 6 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q6F0P3 5.48e-25 102 29 7 239 3 phnC Phosphonates import ATP-binding protein PhnC Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q2JLH7 5.74e-25 102 28 7 230 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q98L75 6.42e-25 102 27 5 238 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q20ZP0 7.04e-25 102 29 6 235 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q2K551 1.13e-24 101 27 5 244 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9AE30 1.71e-24 101 27 5 244 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium leguminosarum
Q132E8 1.94e-24 101 29 5 214 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q5YVL8 3.77e-24 100 29 5 221 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
Q11ID5 4.99e-24 99 27 6 254 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q9KL34 5.31e-24 99 26 5 231 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q62H59 1.02e-23 100 28 9 233 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia mallei (strain ATCC 23344)
Q7W148 1.02e-23 99 30 5 217 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q63NR0 1.26e-23 99 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain K96243)
Q3JHM1 1.26e-23 99 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia pseudomallei (strain 1710b)
Q62A98 1.26e-23 99 28 5 252 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia mallei (strain ATCC 23344)
Q8TQ05 1.81e-23 102 30 8 240 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 7.28e-13 71 24 4 220 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q63R24 1.91e-23 99 28 9 233 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia pseudomallei (strain K96243)
Q3JNY2 1.91e-23 99 28 9 233 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia pseudomallei (strain 1710b)
Q032D0 2e-23 98 30 7 231 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q9CIQ6 2.39e-23 97 30 8 243 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q882S0 3.26e-23 98 26 7 242 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q0B697 3.73e-23 97 28 6 244 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7WNT8 3.82e-23 97 29 5 217 3 phnC Phosphonates import ATP-binding protein PhnC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1H0W2 4.45e-23 97 31 8 241 3 hmuV Hemin import ATP-binding protein HmuV Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q39B28 4.45e-23 97 27 5 254 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q6NBX6 5.63e-23 97 30 6 212 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q07LY2 5.93e-23 97 31 7 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisA53)
Q897I2 7.18e-23 99 31 5 214 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 1.06e-10 64 32 1 104 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q2ISN3 9.16e-23 97 30 6 216 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q16BC5 1e-22 96 28 8 242 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q48HL2 1.09e-22 96 26 8 247 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZU82 1.69e-22 96 25 7 247 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
O57872 1.7e-22 95 30 6 212 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
C3LLU1 2.3e-22 95 28 6 240 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain M66-2)
Q9KSL1 2.3e-22 95 28 6 240 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1V0 3.84e-22 94 27 6 240 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9RZU5 3.88e-22 94 26 6 245 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9KD30 4.49e-22 94 26 5 235 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1BJA5 4.91e-22 95 28 7 249 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 4.91e-22 95 28 7 249 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q9AB70 6.53e-22 94 29 10 242 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q58488 9.12e-22 94 28 5 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A3CVD3 1.24e-21 94 26 5 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8TK65 1.33e-21 96 29 5 226 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q55281 1.4e-21 93 27 6 237 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q74I62 1.65e-21 96 31 4 226 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 9.02e-07 52 25 6 223 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q50801 3.28e-21 92 31 6 215 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q8RD07 4.46e-21 91 32 8 225 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0ASQ1 4.51e-21 92 26 9 236 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
O26236 5.44e-21 92 27 7 234 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8REG7 7.12e-21 91 27 7 222 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q67JX4 7.13e-21 92 26 7 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8CUY0 8.27e-21 91 26 8 249 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8PZN0 8.88e-21 93 29 5 226 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q56953 9.2e-21 92 27 5 233 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q2FRT7 1.49e-20 92 28 6 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8UIW7 1.96e-20 90 26 7 220 3 phnC Phosphonates import ATP-binding protein PhnC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9KFN9 2.28e-20 90 31 10 241 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q88XV1 2.52e-20 90 29 7 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6KHL2 2.52e-20 90 29 6 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q1GMA8 2.53e-20 90 28 7 244 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
P42360 3.13e-20 89 26 4 230 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
O34814 3.2e-20 89 31 10 215 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
Q46TK4 3.8e-20 90 25 8 235 3 phnC Phosphonates import ATP-binding protein PhnC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5FMM1 4.14e-20 89 30 8 236 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B7VPD0 4.34e-20 89 27 8 260 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio atlanticus (strain LGP32)
Q9RKC6 4.74e-20 89 26 2 207 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q38UT9 5.75e-20 89 28 6 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q9WXX8 8.83e-20 88 30 8 238 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9FUT3 1.11e-19 91 32 6 210 1 ABCB23 ABC transporter B family member 23, mitochondrial Arabidopsis thaliana
Q04CG8 1.12e-19 88 31 9 235 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GC08 1.16e-19 88 31 9 235 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q8FAV1 1.19e-19 88 27 8 233 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A3CRB9 1.28e-19 88 28 7 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q6LX68 1.37e-19 88 27 6 234 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q1R3F6 1.53e-19 87 26 7 228 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q3ATR5 1.59e-19 90 33 8 206 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium chlorochromatii (strain CaD3)
Q30W28 1.62e-19 88 26 7 244 3 phnC Phosphonates import ATP-binding protein PhnC Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8U3E0 1.65e-19 88 28 7 225 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6D2F6 1.82e-19 89 29 8 232 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Y7R4 1.87e-19 87 27 5 224 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3YUN6 1.92e-19 87 25 7 228 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
P16677 1.96e-19 87 26 7 228 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
O84071 2.29e-19 87 24 4 237 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q8PSR0 2.41e-19 90 28 6 237 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 1.3e-11 67 23 4 221 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O68106 2.55e-19 87 25 5 226 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q1LKJ2 2.64e-19 88 26 9 246 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P27675 2.73e-19 87 27 8 244 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q7N3Q4 2.84e-19 87 28 5 232 3 btuD Vitamin B12 import ATP-binding protein BtuD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q92EZ6 2.85e-19 88 27 6 225 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q31TP8 2.92e-19 87 25 7 228 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q88XV2 3.02e-19 87 30 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q83P97 3.11e-19 87 26 8 233 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q0SXV5 3.11e-19 87 26 8 233 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q0SWH9 3.34e-19 87 28 5 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q57243 3.5e-19 87 25 4 227 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0T9T7 3.74e-19 87 25 7 228 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q93D97 3.83e-19 89 28 6 242 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 7.93e-11 65 23 6 231 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q13LC4 4.05e-19 87 27 9 244 3 phnC Phosphonates import ATP-binding protein PhnC Paraburkholderia xenovorans (strain LB400)
Q9V2E4 4.05e-19 86 29 7 214 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q8YA75 4.48e-19 87 27 6 225 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8TYV9 5.32e-19 86 29 7 213 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
P54537 6.2e-19 85 28 6 215 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q8RQL7 6.23e-19 85 29 6 215 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0TUN8 6.34e-19 86 28 5 230 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q720M2 6.66e-19 86 26 5 229 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q4L885 6.87e-19 86 28 7 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q724C0 7.38e-19 87 27 6 225 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
O27739 8.62e-19 86 25 6 228 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A0ALT7 1.08e-18 85 28 8 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9HYL7 1.1e-18 85 26 8 234 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9M0G9 1.13e-18 88 31 7 211 1 ABCB24 ABC transporter B family member 24, mitochondrial Arabidopsis thaliana
Q6GEL4 1.19e-18 85 29 8 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q1IGN4 1.21e-18 87 28 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q73F67 1.21e-18 85 28 10 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8XDV7 1.44e-18 85 25 7 228 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q6MIP7 1.56e-18 85 27 7 234 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
O34900 1.6e-18 85 27 4 229 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q2JPW6 1.66e-18 85 25 6 212 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q927N8 1.72e-18 85 30 8 221 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q329I3 1.77e-18 85 26 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q71WH7 1.87e-18 85 29 10 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
P70970 1.96e-18 85 29 5 218 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q92CK1 2.11e-18 85 27 6 226 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q02QM1 2.31e-18 85 26 8 234 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q10V16 2.33e-18 84 26 5 208 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
Q9K8N1 2.55e-18 84 26 6 228 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8XNY7 2.73e-18 85 28 5 230 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q9KFL0 2.75e-18 84 26 6 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6D664 2.77e-18 84 28 8 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q74DN5 2.84e-18 84 27 5 218 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8Y454 2.92e-18 84 30 10 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q4A5A4 3.13e-18 85 29 7 225 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
Q8DY60 3.2e-18 86 28 6 241 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 2.8e-09 60 26 7 231 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q6HPN0 3.42e-18 84 28 10 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 3.42e-18 84 28 10 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 3.42e-18 84 28 10 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q03PY6 3.44e-18 84 27 6 224 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q9PPV1 3.45e-18 84 29 6 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q832R5 3.52e-18 86 29 6 234 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 1.14e-10 64 26 9 225 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q81ZF5 3.57e-18 85 28 7 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q81J15 3.69e-18 84 27 6 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q97SA3 3.84e-18 86 29 4 217 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 8.16e-09 58 27 9 230 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6HP89 3.87e-18 85 28 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q73F66 3.89e-18 84 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5L3Q9 3.97e-18 84 27 5 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
O34697 4e-18 84 28 8 230 1 bceA Bacitracin export ATP-binding protein BceA Bacillus subtilis (strain 168)
A1BE50 4.28e-18 86 29 9 251 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A8AHA1 4.55e-18 83 27 6 254 3 btuD Vitamin B12 import ATP-binding protein BtuD Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MVV6 4.58e-18 84 26 6 246 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio campbellii (strain ATCC BAA-1116)
Q7NX01 5.34e-18 85 28 8 235 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9LVM1 5.4e-18 86 30 8 213 1 ABCB25 ABC transporter B family member 25, mitochondrial Arabidopsis thaliana
O34946 5.51e-18 83 27 7 220 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q3SGJ8 5.75e-18 83 26 6 231 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
P06611 6.13e-18 83 26 5 251 1 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12)
B1XG16 6.13e-18 83 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12 / DH10B)
C4ZYH1 6.13e-18 83 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain K12 / MC4100 / BW2952)
B5BA33 6.19e-18 83 28 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain AKU_12601)
Q5PH81 6.19e-18 83 28 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q63TX3 6.29e-18 84 25 6 227 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q3JSQ0 6.49e-18 84 25 6 227 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 6.49e-18 84 25 6 227 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q9MUN1 6.65e-18 84 27 6 239 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q8U4L3 6.81e-18 83 29 6 212 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q2YYM5 6.97e-18 84 29 8 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q08D64 7.63e-18 85 30 7 218 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
Q6MUF4 8.81e-18 82 28 7 225 3 phnC Phosphonates import ATP-binding protein PhnC Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A0R8K9 9.64e-18 83 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q839D5 9.78e-18 83 28 8 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8E3S6 1.02e-17 85 27 6 241 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 2.53e-09 60 26 8 238 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q63GR8 1.03e-17 84 27 7 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
B2U358 1.1e-17 82 25 5 258 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8TTN2 1.13e-17 84 25 8 251 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1IGZ0 1.13e-17 84 27 6 218 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q8XXY9 1.14e-17 84 27 7 233 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q71WH8 1.15e-17 83 27 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q81IN8 1.21e-17 84 28 7 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q73EL7 1.25e-17 84 27 7 223 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q88RL5 1.32e-17 84 26 6 215 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3Z257 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella sonnei (strain Ss046)
Q7C1M3 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella flexneri
Q0T4R9 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella flexneri serotype 5b (strain 8401)
Q32FJ0 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella dysenteriae serotype 1 (strain Sd197)
B1LE21 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain SMS-3-5 / SECEC)
B6I8R4 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain SE11)
B7N547 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1IPL8 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q1 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O9:H4 (strain HS)
B7M1B8 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O8 (strain IAI1)
B7NTS2 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L6I2 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain 55989 / EAEC)
A7ZMH7 1.33e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O139:H28 (strain E24377A / ETEC)
Q39GT7 1.41e-17 83 26 8 227 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q81J16 1.41e-17 82 27 10 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HPM9 1.41e-17 83 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 1.41e-17 83 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q88RB3 1.47e-17 84 27 5 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P33916 1.48e-17 84 26 8 233 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 2.45e-08 57 24 7 231 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q1RB86 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli (strain UTI89 / UPEC)
Q8FH28 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB9 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABP5 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O1:K1 / APEC
B7MV91 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O81 (strain ED1a)
B7MAS0 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US48 1.49e-17 82 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q14Q07 1.57e-17 83 27 7 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
P42423 1.58e-17 82 29 8 235 2 yxdL ABC transporter ATP-binding protein YxdL Bacillus subtilis (strain 168)
Q839D4 1.58e-17 82 26 6 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q321G6 1.63e-17 82 26 5 247 3 btuD Vitamin B12 import ATP-binding protein BtuD Shigella boydii serotype 4 (strain Sb227)
Q98GF5 1.63e-17 82 25 8 236 3 phnC Phosphonates import ATP-binding protein PhnC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9PKX1 1.73e-17 82 26 5 242 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
Q8GNH6 1.74e-17 83 28 7 209 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q9KTJ5 1.95e-17 83 26 6 214 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7A088 1.95e-17 82 28 7 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 1.95e-17 82 28 7 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 1.95e-17 82 28 7 215 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 1.95e-17 82 28 7 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 1.95e-17 82 28 7 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 1.95e-17 82 28 7 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 1.95e-17 82 28 7 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q82HA2 1.98e-17 82 25 2 208 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8Y455 2.17e-17 82 26 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9K619 2.2e-17 82 28 7 220 3 bceA Bacitracin export ATP-binding protein BceA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q63H62 2.57e-17 82 28 10 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q0I5E9 2.59e-17 83 26 5 215 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q6YR39 2.66e-17 82 30 7 219 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q9CIS8 3e-17 82 28 6 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
A0ALT6 3.03e-17 82 26 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8E9I8 3.17e-17 81 29 9 238 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8ELQ6 3.43e-17 82 29 8 220 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2SR40 3.49e-17 81 27 6 228 3 phnC Phosphonates import ATP-binding protein PhnC Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
B5YPZ7 3.51e-17 81 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5W0 3.51e-17 81 26 5 251 3 btuD Vitamin B12 import ATP-binding protein BtuD Escherichia coli O157:H7
Q04FM1 3.6e-17 82 26 4 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q2SVP3 4.03e-17 82 25 6 227 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q03EE4 4.04e-17 81 27 6 241 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P63351 4.26e-17 81 27 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63352 4.26e-17 81 27 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella typhi
B4TGI0 4.26e-17 81 27 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella heidelberg (strain SL476)
B5FJ99 4.26e-17 81 27 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella dublin (strain CT_02021853)
Q57PU4 4.26e-17 81 27 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella choleraesuis (strain SC-B67)
Q92VJ2 4.57e-17 82 27 7 236 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q52815 4.63e-17 81 27 8 229 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O52618 4.74e-17 82 28 7 209 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
B5QVV9 4.81e-17 80 27 6 242 3 btuD Vitamin B12 import ATP-binding protein BtuD Salmonella enteritidis PT4 (strain P125109)
Q03ZL5 5.17e-17 81 26 7 225 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1BWI2 5.28e-17 81 26 7 223 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q8YUV1 5.6e-17 80 28 7 231 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q737I0 5.71e-17 83 27 4 216 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 1.24e-07 55 25 6 223 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q927N9 6.25e-17 81 26 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8RCU0 6.48e-17 80 28 7 216 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7A1Z1 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MW2)
Q6GCY2 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MSSA476)
Q7A848 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain N315)
Q99X73 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJM6 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain COL)
Q2G1L8 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKB7 6.75e-17 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain USA300)
Q6YRJ4 6.77e-17 82 27 5 217 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q166X0 6.82e-17 80 28 6 218 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1M7W6 6.97e-17 81 26 7 215 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P39456 7.01e-17 80 27 4 220 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q50293 7.19e-17 81 26 5 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q93KD4 7.63e-17 79 29 6 196 1 tupC Tungstate uptake system ATP-binding protein TupC Peptoclostridium acidaminophilum
Q8ES39 7.86e-17 82 29 7 225 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 3.55e-07 53 25 8 222 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q831K6 7.91e-17 81 29 5 216 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
P33360 8.16e-17 81 25 5 214 1 yehX Glycine betaine uptake system ATP-binding protein YehX Escherichia coli (strain K12)
P37774 8.3e-17 80 27 6 236 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q65P76 8.39e-17 80 27 5 216 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q4ZZK0 8.66e-17 82 28 7 215 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. syringae (strain B728a)
P48334 8.79e-17 80 26 6 223 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
Q046T0 9.04e-17 80 28 9 239 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q92V71 9.4e-17 80 26 7 223 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q8DQY5 9.57e-17 82 28 4 217 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 3.39e-08 57 28 9 231 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q82WT5 9.77e-17 81 26 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2NUA5 1.05e-16 82 26 7 228 3 msbA ATP-dependent lipid A-core flippase Sodalis glossinidius (strain morsitans)
Q1J982 1.1e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8D2U8 1.11e-16 82 25 7 223 3 msbA ATP-dependent lipid A-core flippase Wigglesworthia glossinidia brevipalpis
Q2YUY7 1.12e-16 80 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9HT70 1.14e-16 81 27 5 216 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 1.14e-16 81 27 5 216 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7MLE6 1.15e-16 80 26 6 246 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio vulnificus (strain YJ016)
Q03ZL6 1.23e-16 80 26 8 255 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P44785 1.27e-16 81 25 6 217 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2K8C8 1.29e-16 81 26 7 234 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2NIT5 1.29e-16 80 29 5 213 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
P44662 1.3e-16 80 24 6 234 3 HI_0361 Probable iron transport system ATP-binding protein HI_0361 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8R7Y4 1.32e-16 80 30 9 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1RGD0 1.36e-16 79 28 5 214 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain UTI89 / UPEC)
Q8KLG1 1.36e-16 80 23 9 260 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q748K0 1.48e-16 80 28 5 214 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P0C2H2 1.48e-16 82 28 7 210 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli
P0C2H3 1.48e-16 82 28 7 210 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Escherichia coli O1:K1 / APEC
Q28K97 1.51e-16 80 29 7 209 3 tauB Taurine import ATP-binding protein TauB Jannaschia sp. (strain CCS1)
Q48PN3 1.57e-16 81 27 5 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6GKG3 1.65e-16 79 28 8 230 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MRSA252)
Q7N6Z2 1.66e-16 80 29 9 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1LQD3 1.73e-16 81 28 7 225 3 msbA ATP-dependent lipid A-core flippase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q48QM2 1.74e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.74e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.74e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
P0C0E9 1.75e-16 80 29 6 216 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.75e-16 80 29 6 216 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q87UV4 1.76e-16 80 27 7 215 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q02151 1.8e-16 79 25 3 227 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
Q3KJS6 1.83e-16 80 26 7 215 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q8ZX91 1.87e-16 79 24 4 219 3 pstB Phosphate import ATP-binding protein PstB Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
P08720 1.93e-16 80 26 7 215 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
Q65P77 1.95e-16 79 30 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6D5H7 1.98e-16 80 25 5 234 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P72477 2.02e-16 79 27 5 220 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2KBP5 2.03e-16 79 28 7 211 1 bioM Biotin transport ATP-binding protein BioM Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q11D92 2.07e-16 79 29 5 195 3 thiQ Thiamine import ATP-binding protein ThiQ Chelativorans sp. (strain BNC1)
Q8R7Y5 2.14e-16 79 27 8 228 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0TLS2 2.15e-16 79 28 5 214 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1MMZ3 2.15e-16 79 25 8 229 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8FL82 2.17e-16 79 28 5 214 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5LVC2 2.21e-16 79 31 8 211 3 phnC Phosphonates import ATP-binding protein PhnC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5E586 2.33e-16 80 27 6 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
A0A125QXJ1 2.43e-16 81 30 7 209 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q9NP58 2.45e-16 81 31 7 209 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q8NQH4 2.46e-16 79 29 7 233 3 phnC Phosphonates import ATP-binding protein PhnC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6F9A8 2.49e-16 80 28 8 237 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9V1Q4 2.63e-16 79 24 6 230 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q46YX6 2.89e-16 80 27 7 233 3 nodI Nod factor export ATP-binding protein I Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q4L9P7 2.9e-16 79 28 9 248 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus haemolyticus (strain JCSC1435)
Q8DMX9 2.92e-16 79 28 5 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 2.92e-16 79 28 5 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 2.92e-16 79 28 5 223 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03PY5 2.93e-16 79 27 5 223 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
O34677 2.98e-16 78 25 6 244 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q3A9G5 3.03e-16 80 26 6 215 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q2S3A3 3.19e-16 79 31 6 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salinibacter ruber (strain DSM 13855 / M31)
Q6KHL1 3.36e-16 79 29 8 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q5L3R0 3.62e-16 79 28 6 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
P45073 3.67e-16 78 26 7 228 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65VG9 3.68e-16 79 25 6 216 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q032H3 3.73e-16 79 27 5 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q7MN25 3.76e-16 79 25 7 217 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q4QMH4 3.79e-16 79 25 6 217 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q9DC29 3.79e-16 80 30 7 209 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
Q83MG3 3.84e-16 78 27 6 233 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
A2RI02 3.96e-16 79 27 5 217 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q21GS5 4e-16 79 29 6 207 3 modC Molybdenum import ATP-binding protein ModC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q98FA5 4.02e-16 78 27 6 202 3 thiQ Thiamine import ATP-binding protein ThiQ Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8DFC3 4.02e-16 79 25 7 217 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q4KK46 4.07e-16 80 27 7 215 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q18CI9 4.08e-16 79 25 4 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
P47426 4.25e-16 79 26 4 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9C9W0 4.33e-16 78 27 6 226 2 ABCI17 ABC transporter I family member 17 Arabidopsis thaliana
P40735 4.53e-16 79 30 6 217 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q8G5P8 4.64e-16 80 27 7 242 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q5WIL7 5.04e-16 78 30 9 230 3 phnC Phosphonates import ATP-binding protein PhnC Shouchella clausii (strain KSM-K16)
Q9ZKW3 5.17e-16 78 25 5 247 3 jhp_0821 Probable iron chelatin transport ATP-binding protein jhp_0821 Helicobacter pylori (strain J99 / ATCC 700824)
Q87RS1 5.19e-16 79 25 8 215 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q48QM3 5.2e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q03203 5.26e-16 80 30 10 242 3 nisT Nisin transport ATP-binding protein NisT Lactococcus lactis subsp. lactis
A2RH10 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 5.31e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q38WL5 5.45e-16 79 27 5 214 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q18C09 5.46e-16 79 24 9 249 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q7UC29 5.46e-16 79 28 7 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q6D654 5.65e-16 78 29 5 225 3 btuD Vitamin B12 import ATP-binding protein BtuD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8XBJ8 5.74e-16 79 28 7 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q5FM63 5.79e-16 78 25 6 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P0CZ27 5.87e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 5.87e-16 78 27 6 207 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q6AJW3 6e-16 80 28 6 224 3 msbA ATP-dependent lipid A-core flippase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q48PU6 6.06e-16 79 27 6 218 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P16676 6.08e-16 79 28 7 234 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8YUI9 6.19e-16 77 28 5 223 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9X196 6.26e-16 79 31 11 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q60AA3 6.36e-16 80 26 7 250 3 msbA ATP-dependent lipid A-core flippase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9Z8Q8 6.48e-16 79 25 7 219 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q8RGC8 6.5e-16 79 27 6 219 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8DQH4 6.58e-16 77 26 7 229 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 6.58e-16 77 26 7 229 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8ETV6 6.74e-16 78 25 6 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8FFB3 6.84e-16 79 28 7 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P26050 7.58e-16 78 27 7 212 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9KGD6 7.97e-16 78 27 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q4KJB2 8.06e-16 79 28 5 221 3 msbA ATP-dependent lipid A-core flippase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q57S53 8.1e-16 79 27 7 221 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q81PZ8 8.16e-16 79 27 5 217 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 1.4e-08 58 25 7 230 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q1GKZ0 8.33e-16 77 29 6 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Ruegeria sp. (strain TM1040)
Q02ME3 8.35e-16 79 25 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8D928 8.63e-16 77 26 6 246 3 btuD Vitamin B12 import ATP-binding protein BtuD Vibrio vulnificus (strain CMCP6)
O34362 8.74e-16 79 25 4 230 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 1.66e-10 63 26 8 240 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q7NAQ7 8.79e-16 78 28 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q21Y06 8.88e-16 77 25 6 227 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q4KKK8 9.07e-16 78 27 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q63H61 9.34e-16 78 27 5 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q97ZT9 9.38e-16 77 25 5 230 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q98G43 9.4e-16 79 30 9 221 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P50332 9.47e-16 78 29 10 210 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
Q9I1C8 9.48e-16 79 25 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05285
Feature type CDS
Gene -
Product ABC transporter ATP-binding protein
Location 1123675 - 1124415 (strand: -1)
Length 741 (nucleotides) / 246 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_688
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1120 Inorganic ion transport and metabolism (P)
Coenzyme transport and metabolism (H)		 PH ABC-type cobalamin/Fe3+-siderophores transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] - -

Protein Sequence

MSTVDVTDLNYNGILKDISLSFSGKHIIGIVGPNGSGKTTLLRHIYRDIKTKKTVFLDKTDIAAFSIKSLARHISVLTQFNDQVEGKLTIEEIAVMGRMPYKKHYVDYSHNDFLIADRYMALFGLQTMRHKEYHDLSGGEKQRVMLAKCFSQETDIMILDEPTNHLDVRYKVEVMKALAASDATVIMTIHDINLAAKYCRYLIMMKDGEIYAQGTPAQVFTKECLFDVFGVEFTILPVDDRVAIFL

Flanking regions ( +/- flanking 50bp)

TGCGCCGTTGTTTGTTTATATCATTATCAAAGGAAACCGGAGCCGATAACATGAGTACTGTTGATGTTACTGACCTGAACTATAACGGAATACTGAAAGATATTTCGTTATCATTTTCCGGTAAACATATTATTGGTATTGTCGGGCCTAATGGTTCAGGTAAAACAACGCTGCTGAGACATATTTACCGCGATATAAAAACAAAAAAAACCGTCTTTCTTGATAAGACGGATATTGCTGCATTTTCGATAAAATCGCTTGCCCGTCATATATCAGTACTGACTCAGTTTAATGATCAGGTAGAAGGAAAACTGACCATTGAAGAGATAGCGGTTATGGGCAGAATGCCGTATAAAAAACATTATGTTGATTACAGTCACAACGATTTTCTGATAGCAGACCGCTATATGGCATTATTTGGCCTGCAAACCATGAGACATAAAGAGTATCACGATTTATCCGGCGGTGAAAAACAGCGGGTTATGCTGGCAAAATGTTTCTCACAGGAAACAGATATCATGATCCTCGATGAGCCGACAAACCATCTGGATGTCAGGTATAAAGTTGAGGTAATGAAAGCATTAGCGGCGTCAGATGCGACGGTTATCATGACGATTCACGATATTAATTTAGCCGCCAAATATTGCCGGTATCTTATTATGATGAAAGACGGTGAAATTTATGCACAGGGAACACCTGCGCAGGTATTTACCAAAGAGTGTCTGTTTGATGTATTTGGTGTGGAATTTACCATACTACCGGTCGATGATCGTGTGGCTATATTTCTCTGAATTAGTTTGTGTTTGTAACCCGGAGAGGGAATGATGAAAAAATTATTACT