Homologs in group_685

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01930 FBDBKF_01930 83.8 Morganella morganii S1 prmC peptide chain release factor N(5)-glutamine methyltransferase
EHELCC_02400 EHELCC_02400 83.8 Morganella morganii S2 prmC peptide chain release factor N(5)-glutamine methyltransferase
NLDBIP_01060 NLDBIP_01060 83.8 Morganella morganii S4 prmC peptide chain release factor N(5)-glutamine methyltransferase
LHKJJB_00975 LHKJJB_00975 83.8 Morganella morganii S3 prmC peptide chain release factor N(5)-glutamine methyltransferase
HKOGLL_01015 HKOGLL_01015 83.8 Morganella morganii S5 prmC peptide chain release factor N(5)-glutamine methyltransferase
PMI_RS05270 PMI_RS05270 64.0 Proteus mirabilis HI4320 prmC peptide chain release factor N(5)-glutamine methyltransferase

Distribution of the homologs in the orthogroup group_685

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_685

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P40816 1.8e-120 348 64 0 274 3 prmC Release factor glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ACC2 1.88e-120 348 62 0 274 3 prmC Release factor glutamine methyltransferase Shigella flexneri
P0ACC1 1.88e-120 348 62 0 274 1 prmC Release factor glutamine methyltransferase Escherichia coli (strain K12)
Q32GZ5 1.05e-119 346 62 0 274 3 prmC Release factor glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q7CIA2 2.93e-116 338 60 1 274 3 prmC Release factor glutamine methyltransferase Yersinia pestis
Q5E6T2 2.1e-101 300 57 1 259 3 prmC Release factor glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9KQ26 5.68e-99 294 55 2 277 3 prmC Release factor glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P57269 2.38e-93 280 46 1 278 3 prmC Release factor glutamine methyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P45253 1.28e-89 271 52 6 290 3 prmC Release factor glutamine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8EAR4 1.42e-85 260 50 0 258 3 prmC Release factor glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8K9W9 6.89e-84 255 44 1 276 3 prmC Release factor glutamine methyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9HVC8 5.33e-83 253 52 0 263 3 prmC Release factor glutamine methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q89AT0 5.94e-81 248 46 3 278 3 prmC Release factor glutamine methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8PC99 1.96e-75 234 47 2 275 3 prmC Release factor glutamine methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9CN82 1.32e-74 233 48 6 296 3 prmC Release factor glutamine methyltransferase Pasteurella multocida (strain Pm70)
Q83AD8 5.18e-69 218 41 2 260 3 prmC Release factor glutamine methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q87DF7 9.01e-68 214 45 2 269 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PD67 2.27e-67 213 45 1 255 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
Q5F5B4 3.5e-64 205 44 4 276 3 prmC Release factor glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7W022 2.61e-58 190 43 3 256 3 prmC Release factor glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q63QE9 2.54e-57 188 43 4 260 3 prmC Release factor glutamine methyltransferase Burkholderia pseudomallei (strain K96243)
Q5NIA7 5.68e-54 179 36 2 277 3 prmC Release factor glutamine methyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q1II29 2.06e-53 177 38 6 280 3 prmC Release factor glutamine methyltransferase Koribacter versatilis (strain Ellin345)
Q98G94 9.19e-52 174 41 4 262 3 prmC Release factor glutamine methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2RWE0 1.29e-50 172 40 3 265 3 prmC Release factor glutamine methyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8R619 1.27e-48 167 33 4 261 3 prmC Release factor glutamine methyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q748B2 5.51e-48 164 39 3 258 3 prmC Release factor glutamine methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2RFW1 5.39e-46 159 39 4 283 3 prmC Release factor glutamine methyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8DPZ3 7.85e-46 158 39 4 237 3 prmC Release factor glutamine methyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q1RH40 4.4e-45 162 31 5 300 3 prmC/trmB Bifunctional methyltransferase Rickettsia bellii (strain RML369-C)
Q9A9T7 3.43e-43 151 36 5 278 3 prmC Release factor glutamine methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A9CG70 5.32e-43 151 39 5 266 3 prmC Release factor glutamine methyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q7ULT2 1.28e-42 150 36 8 271 3 prmC Release factor glutamine methyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q92G13 1.8e-42 155 32 4 281 3 prmC/trmB Bifunctional methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q68VR6 2.55e-42 154 32 4 272 3 prmC/trmB Bifunctional methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UJU4 2.45e-41 152 34 5 285 3 prmC/trmB Bifunctional methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZCB3 4.51e-41 151 32 3 272 3 prmC/trmB Bifunctional methyltransferase Rickettsia prowazekii (strain Madrid E)
O66506 2.85e-40 144 33 3 257 3 prmC Release factor glutamine methyltransferase Aquifex aeolicus (strain VF5)
Q97F67 3.73e-40 144 31 3 273 3 prmC Release factor glutamine methyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A9WBM9 1.06e-39 142 36 8 280 3 prmC Release factor glutamine methyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q727D9 2.97e-38 139 36 4 263 3 prmC Release factor glutamine methyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B5YIQ8 7.08e-37 135 31 3 258 3 prmC Release factor glutamine methyltransferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q8KCD5 1.23e-34 129 36 6 264 3 prmC Release factor glutamine methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9RXR2 4.86e-34 127 34 5 278 3 prmC Release factor glutamine methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q89XT8 2.12e-33 126 39 2 209 3 prmC Release factor glutamine methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2S0V8 2.51e-33 126 33 5 264 3 prmC Release factor glutamine methyltransferase Salinibacter ruber (strain DSM 13855 / M31)
Q831F7 2.8e-33 125 34 3 210 3 prmC Release factor glutamine methyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q9CHX0 5.54e-33 124 37 5 227 3 prmC Release factor glutamine methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
P45873 1.87e-32 124 34 6 270 3 prmC Release factor glutamine methyltransferase Bacillus subtilis (strain 168)
Q7NJS7 2.59e-32 123 33 6 272 3 prmC Release factor glutamine methyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8Y4A9 6.65e-31 119 36 8 255 3 prmC Release factor glutamine methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3J2B7 5.02e-30 117 37 7 270 3 prmC Release factor glutamine methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A0R213 1.86e-29 115 33 7 262 3 prmC Release factor glutamine methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A6H162 2.63e-29 115 32 6 224 3 prmC Release factor glutamine methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B8E004 2.15e-28 112 30 10 286 3 prmC Release factor glutamine methyltransferase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q8F987 7.49e-28 111 32 6 259 3 prmC Release factor glutamine methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8G3P4 8.69e-28 111 30 8 272 3 prmC Release factor glutamine methyltransferase Bifidobacterium longum (strain NCC 2705)
Q8DHV7 1.58e-27 110 35 5 221 3 prmC Release factor glutamine methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8A1D7 1.58e-27 110 31 5 241 3 prmC Release factor glutamine methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A5HY34 7.57e-27 108 29 3 258 3 prmC Release factor glutamine methyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Q814U1 2.92e-26 107 29 5 261 3 prmC Release factor glutamine methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9K4E3 9.56e-26 105 34 6 251 3 prmC Release factor glutamine methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P74003 1.51e-25 105 32 6 240 3 prmC Release factor glutamine methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2FWE1 2.07e-25 104 33 4 199 3 prmC Release factor glutamine methyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q81JX2 3.48e-25 104 29 5 261 3 prmC Release factor glutamine methyltransferase Bacillus anthracis
Q6MU88 6.48e-25 103 26 5 256 3 prmC Release factor glutamine methyltransferase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
P45106 2.17e-24 102 35 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8P7Q8 3.09e-24 102 34 5 225 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P45832 2.04e-23 99 28 7 286 3 prmC Release factor glutamine methyltransferase Mycobacterium leprae (strain TN)
Q9CNN7 2.64e-23 100 35 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pasteurella multocida (strain Pm70)
B0B9D1 2.75e-23 99 34 7 254 1 prmC Release factor glutamine methyltransferase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84027 3.31e-23 99 33 7 254 3 prmC Release factor glutamine methyltransferase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P9WHV2 3.71e-22 96 28 8 266 3 prmC Release factor glutamine methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9WYV8 4.59e-22 95 33 8 254 1 prmC Release factor glutamine methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P39199 1.33e-21 95 35 3 196 1 prmB Ribosomal protein uL3 glutamine methyltransferase Escherichia coli (strain K12)
P0DJB1 1.6e-21 94 30 7 218 3 prmC Release factor glutamine methyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QDG2 1.6e-21 94 30 7 218 3 prmC Release factor glutamine methyltransferase Corynebacterium glutamicum (strain R)
Q9PDL1 1.7e-21 95 32 3 224 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
O51215 2.2e-21 94 30 8 220 3 prmC Release factor glutamine methyltransferase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9I347 4.38e-21 93 34 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0WDE1 5.35e-21 93 33 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Yersinia pestis
Q32DK7 6.68e-21 93 34 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
P0A293 7.85e-21 93 34 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A294 7.85e-21 93 34 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhi
P39200 8.26e-21 93 32 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio anguillarum (strain ATCC 68554 / 775)
Q6F0I4 1.32e-20 92 28 5 238 3 prmC Release factor glutamine methyltransferase Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q5E3U5 1.47e-20 92 32 3 199 3 prmB Ribosomal protein uL3 glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P9WHV3 2.57e-20 91 28 8 266 1 prmC Release factor glutamine methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q87DS5 2.76e-20 91 32 3 224 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9KQ83 3.23e-19 89 33 3 196 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ECQ4 8.1e-19 87 33 5 200 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VDL7 1.04e-18 87 33 6 218 3 prmC Release factor glutamine methyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q9Y5R4 2.34e-18 86 28 6 270 1 HEMK1 MTRF1L release factor glutamine methyltransferase Homo sapiens
Q921L7 2.23e-17 84 29 6 276 2 Hemk1 MTRF1L release factor glutamine methyltransferase Mus musculus
Q89DG5 6.83e-16 79 28 4 221 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5NEL0 7.46e-16 79 31 3 183 3 prmB Ribosomal protein uL3 glutamine methyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
P75419 2.69e-15 79 34 5 169 4 MPN_362 Uncharacterized protein MG259 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9JTA1 1.63e-13 72 26 8 293 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JYC0 1.71e-13 72 26 8 293 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7VXJ6 1.72e-13 72 28 5 239 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P53944 6.83e-13 70 29 5 186 1 MTQ1 Mitochondrial MRF1 N(5)-glutamine methyltransferase MTQ1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P72542 1.32e-12 69 27 3 244 1 papM 4-amino-L-phenylalanine/4-methylamino-L-phenylalanine methyltransferase Streptomyces pristinaespiralis
Q5F783 6.09e-12 68 25 8 293 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q49404 6.11e-11 65 30 7 166 4 MG259 Uncharacterized protein MG259 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q63SZ9 7.12e-11 65 25 7 260 3 prmB Ribosomal protein uL3 glutamine methyltransferase Burkholderia pseudomallei (strain K96243)
Q58338 8.36e-11 63 30 5 157 3 MJ0928 Putative protein N5-glutamine methyltransferase MJ0928 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O14028 1.15e-09 61 27 10 248 3 mtq1 Probable MRF1 mitochondrial N(5)-glutamine methyltransferase mtq1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P37872 3.41e-09 58 41 1 74 3 ybxB Uncharacterized protein YbxB Bacillus subtilis (strain 168)
C6X2D2 3.59e-09 59 35 1 82 3 FIC_02159 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacteriaceae bacterium (strain 3519-10)
B8F678 1.08e-07 55 31 4 132 3 HAPS_1234 tRNA1(Val) (adenine(37)-N6)-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q87SB8 1.82e-07 54 36 2 91 3 VP0506 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MXM2 1.93e-07 54 32 2 91 3 VIBHAR_00953 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q0I4T7 5.05e-07 53 38 2 81 3 HS_1296 tRNA1(Val) (adenine(37)-N6)-methyltransferase Histophilus somni (strain 129Pt)
P9WKL5 6.12e-07 52 40 5 119 1 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKL4 6.12e-07 52 40 5 119 3 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZU0 6.12e-07 52 40 5 119 1 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KG37 6.12e-07 52 40 5 119 1 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q65W50 6.96e-07 52 39 4 86 3 MS0203 tRNA1(Val) (adenine(37)-N6)-methyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6L532 1.31e-06 52 39 3 86 3 BVU_3164 tRNA1(Val) (adenine(37)-N6)-methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
C6Y2G0 1.4e-06 51 41 3 92 3 Phep_2972 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)
B0UWL8 1.03e-05 49 37 2 81 3 HSM_0322 tRNA1(Val) (adenine(37)-N6)-methyltransferase Histophilus somni (strain 2336)
Q5E7Q6 1.24e-05 48 30 2 85 3 VF_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q119M4 1.42e-05 48 27 5 159 3 Tery_0325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Trichodesmium erythraeum (strain IMS101)
Q7MNQ4 1.43e-05 48 30 2 92 3 VV0662 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain YJ016)
C5BAI6 1.66e-05 48 35 3 81 3 NT01EI_3041 tRNA1(Val) (adenine(37)-N6)-methyltransferase Edwardsiella ictaluri (strain 93-146)
Q8DEQ3 2.28e-05 48 30 2 92 3 VV1_0533 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain CMCP6)
Q9KL20 2.69e-05 48 23 5 207 3 rlmC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A4TKY7 2.8e-05 48 34 3 82 3 YPDSF_1562 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CKF3 2.8e-05 48 34 3 82 3 YPN_1197 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3Z3 2.8e-05 48 34 3 82 3 YpAngola_A3602 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q1C564 2.8e-05 48 34 3 82 3 YPA_2443 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFT0 2.8e-05 48 34 3 82 3 YpsIP31758_1127 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B4TGY8 3.28e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella heidelberg (strain SL476)
Q667U2 3.32e-05 47 34 3 82 3 YPTB2899 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q74SR9 3.32e-05 47 34 3 82 3 YPO2709 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis
B2KA56 3.32e-05 47 34 3 82 3 YPTS_3010 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B5BL07 3.4e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella paratyphi A (strain AKU_12601)
Q5PK16 3.4e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B1JRB8 3.42e-05 47 34 3 82 3 YPK_1180 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A8ALZ1 3.5e-05 48 38 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TU29 3.56e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella schwarzengrund (strain CVM19633)
B5R9T9 3.56e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5F512 3.56e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella agona (strain SL483)
Q8ZJW6 3.59e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R2I6 3.59e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella enteritidis PT4 (strain P125109)
B5FTB3 3.59e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella dublin (strain CT_02021853)
Q57G51 3.59e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella choleraesuis (strain SC-B67)
Q8Z0V2 3.76e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella typhi
A9N7C4 3.76e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T4F9 3.76e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella newport (strain SL254)
Q58292 3.96e-05 47 35 2 76 1 MJ0882 Probable S-adenosylmethionine-dependent methyltransferase MJ0882 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A9MRB9 3.97e-05 48 34 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7VJ58 5.77e-05 47 29 1 81 3 VS_0507 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio atlanticus (strain LGP32)
Q0SX40 6.44e-05 47 37 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella flexneri serotype 5b (strain 8401)
B5F9T8 7.31e-05 46 31 3 93 3 VFMJ11_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain MJ11)
A8AD10 0.000104 46 38 6 98 3 CKO_00207 tRNA1(Val) (adenine(37)-N6)-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4F055 0.000105 46 34 2 83 3 PMI1896 tRNA1(Val) (adenine(37)-N6)-methyltransferase Proteus mirabilis (strain HI4320)
A5UGT6 0.000111 46 32 2 82 3 CGSHiGG_05325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittGG)
Q3IG80 0.000113 46 31 4 93 3 PSHAa0511 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pseudoalteromonas translucida (strain TAC 125)
B7NVD9 0.000118 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FA64 0.000121 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A5UA66 0.000124 45 32 3 87 3 CGSHiEE_00885 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittEE)
Q0T8U3 0.000139 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MTB6 0.00014 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O81 (strain ED1a)
Q1R2D5 0.000143 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain UTI89 / UPEC)
A1AJP2 0.000143 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O1:K1 / APEC
Q8A9H7 0.000145 45 34 2 81 3 BT_0838 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B7NH38 0.000152 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B3H2W9 0.000154 45 36 2 80 3 APP7_1987 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q327M6 0.000162 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella dysenteriae serotype 1 (strain Sd197)
P39406 0.000162 46 36 3 88 1 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain K12)
B1XFI0 0.000162 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain K12 / DH10B)
B7MNC1 0.000162 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LEL6 0.000168 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain 55989 / EAEC)
B1IS49 0.00017 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B5Z4Q2 0.00017 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X510 0.00017 46 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O157:H7
A3N3J4 0.000175 45 36 2 80 3 APL_1900 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C3LWJ3 0.000188 45 22 5 207 3 rlmC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC Vibrio cholerae serotype O1 (strain M66-2)
A5F0U5 0.000188 45 22 5 207 3 rlmC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B2TZQ2 0.000209 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6VKA4 0.000211 45 39 3 87 3 Asuc_0019 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q820Z6 0.000215 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella flexneri
B7LNK6 0.000233 45 35 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LEH4 0.000237 45 35 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain SMS-3-5 / SECEC)
A8APY0 0.00025 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MPU2 0.000267 45 33 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A3DBD7 0.000267 45 43 0 48 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2JJQ0 0.00027 45 44 0 50 3 trmB tRNA (guanine-N(7)-)-methyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
C5BED3 0.000289 45 36 2 79 3 rlmC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC Edwardsiella ictaluri (strain 93-146)
C4LCN4 0.000298 44 28 7 181 3 Tola_0970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q89AI2 0.000322 45 30 2 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
C6AQR4 0.000349 44 36 2 83 3 NT05HA_1847 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aggregatibacter aphrophilus (strain NJ8700)
A0KPC4 0.00035 44 37 3 77 3 AHA_3669 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3YU23 0.000353 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella sonnei (strain Ss046)
Q31SW8 0.000356 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Shigella boydii serotype 4 (strain Sb227)
B6I2Q2 0.000363 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli (strain SE11)
A8A899 0.000363 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O9:H4 (strain HS)
B7LXT2 0.000363 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O8 (strain IAI1)
A7ZVR0 0.000363 45 36 3 88 3 rsmC Ribosomal RNA small subunit methyltransferase C Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8ZLX5 0.000404 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3L8 0.000404 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella typhi
B4TVV4 0.000404 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella schwarzengrund (strain CVM19633)
B5BG31 0.000404 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella paratyphi A (strain AKU_12601)
A9N601 0.000404 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PC93 0.000404 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TIU8 0.000411 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella heidelberg (strain SL476)
B5QZ55 0.000415 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella enteritidis PT4 (strain P125109)
B5FHV5 0.000415 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella dublin (strain CT_02021853)
B5REH7 0.000426 45 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4T690 0.000471 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella newport (strain SL254)
Q57JN9 0.000471 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella choleraesuis (strain SC-B67)
B5F6B6 0.000471 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Salmonella agona (strain SL483)
P42596 0.000524 44 34 2 78 1 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain K12)
B1IRN3 0.000524 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XG88 0.000524 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain K12 / DH10B)
B5Y286 0.000529 44 33 1 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Klebsiella pneumoniae (strain 342)
Q32BN8 0.000534 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella dysenteriae serotype 1 (strain Sd197)
B1LFI2 0.000544 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain SMS-3-5 / SECEC)
Q0TD22 0.000544 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5YRC4 0.000553 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAK8 0.000553 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O157:H7
Q1R6P6 0.000564 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli (strain UTI89 / UPEC)
Q8FDE5 0.000564 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AG02 0.000564 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O1:K1 / APEC
B1JL46 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EW9 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQK1 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis (strain Pestoides F)
Q1CN00 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis bv. Antiqua (strain Nepal516)
A9R058 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis bv. Antiqua (strain Angola)
Q7CG56 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis
B2K3H9 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C153 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMI4 0.000569 44 34 3 78 3 rsmC Ribosomal RNA small subunit methyltransferase C Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4W687 0.000663 44 31 1 82 3 rsmC Ribosomal RNA small subunit methyltransferase C Enterobacter sp. (strain 638)
A7ZRW7 0.000699 44 33 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YXQ6 0.000758 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella sonnei (strain Ss046)
Q31WU9 0.000758 44 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella boydii serotype 4 (strain Sb227)
B2U1T3 0.000793 43 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A0KPP9 0.000802 43 36 3 84 3 rsmC Ribosomal RNA small subunit methyltransferase C Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q821A5 0.000808 43 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella flexneri
Q0T0I4 0.000815 43 34 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Shigella flexneri serotype 5b (strain 8401)
Q2JRH1 0.000825 43 42 0 50 3 trmB tRNA (guanine-N(7)-)-methyltransferase Synechococcus sp. (strain JA-3-3Ab)
Q057M1 0.00084 43 33 3 77 3 rsmC Ribosomal RNA small subunit methyltransferase C Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B1KHR8 0.000851 43 29 7 158 3 rsmC Ribosomal RNA small subunit methyltransferase C Shewanella woodyi (strain ATCC 51908 / MS32)
A7MGA7 0.000862 43 36 3 86 3 rsmC Ribosomal RNA small subunit methyltransferase C Cronobacter sakazakii (strain ATCC BAA-894)
A6VKU5 0.000875 43 37 3 78 3 rlmC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A8A4P1 0.000876 43 33 2 78 3 rlmG Ribosomal RNA large subunit methyltransferase G Escherichia coli O9:H4 (strain HS)
A1JKJ4 0.000883 43 36 2 79 3 YE1008 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8IZ69 0.001 43 35 5 109 1 TRMT2A tRNA (uracil-5-)-methyltransferase homolog A Homo sapiens
B2RK25 0.001 43 35 2 92 3 PGN_1201 tRNA1(Val) (adenine(37)-N6)-methyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04275
Feature type CDS
Gene prmC
Product peptide chain release factor N(5)-glutamine methyltransferase
Location 903780 - 904616 (strand: 1)
Length 837 (nucleotides) / 278 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_685
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05175 Methyltransferase small domain
PF17827 PrmC N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2890 Translation, ribosomal structure and biogenesis (J) J Methylase of polypeptide chain release factors

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02493 release factor glutamine methyltransferase [EC:2.1.1.297] - -

Protein Sequence

MTFRTWLAAAITRLCHSDSPKRDAEILLGHVTGRSRSYIFAFDETALSDDEQQRLESLLIRREQGEPVAYITGSREFWSLPVQVSPATLIPRPDTECLVEAALELLPAGACDILDLGTGTGAIALALASERPDCTVTGVDIQPGAVELARLNATQLALNNVSFKESCWFASLAIHQFAMIVSNPPYIDENDEHLALGDVRFEPRSALVAGQNGLADLADIAQASSDYLQSGGWLVVEHGWRQGDAVRELFRKNGFCRVETRRDYGGNERVTLGQREEK

Flanking regions ( +/- flanking 50bp)

ATTAATGAATATCAGGCAGATCAGCTCGCGGCGCTGTCTGATCAGGACTGATGACTTTCCGTACCTGGCTGGCGGCCGCAATCACACGTCTTTGTCACAGTGACAGCCCGAAACGCGATGCGGAGATTTTGCTCGGGCATGTTACCGGGCGCAGCCGCAGCTATATTTTTGCATTTGATGAAACTGCACTGAGTGATGATGAACAGCAGCGCCTTGAATCGCTGCTGATAAGGCGTGAACAGGGTGAGCCGGTAGCATATATCACCGGCTCACGTGAATTCTGGTCGCTCCCGGTACAGGTATCACCGGCAACACTTATTCCGCGTCCGGATACCGAATGTCTGGTGGAAGCCGCACTTGAGCTGCTGCCTGCGGGTGCCTGTGATATTCTCGATCTTGGCACCGGCACCGGGGCTATTGCGCTGGCGCTGGCATCCGAACGCCCGGATTGTACTGTCACCGGGGTGGATATTCAGCCCGGTGCGGTGGAACTGGCACGTCTCAATGCCACTCAGCTGGCACTTAATAATGTTTCCTTTAAAGAAAGTTGCTGGTTTGCTTCACTGGCGATCCATCAATTTGCTATGATAGTGAGTAACCCGCCTTATATTGATGAAAATGATGAACATCTGGCACTGGGTGATGTCCGTTTCGAGCCGCGCAGCGCACTGGTTGCGGGACAGAACGGGCTTGCCGATTTAGCTGATATTGCGCAGGCGTCATCAGATTATCTGCAATCCGGCGGGTGGTTAGTCGTGGAGCATGGCTGGCGGCAGGGTGATGCCGTCCGTGAACTGTTCCGGAAAAACGGATTTTGCCGGGTGGAAACCCGCCGCGATTATGGTGGAAATGAGCGGGTTACTTTAGGTCAACGGGAAGAGAAATGAAAAGCATTGCCGATTTTGAGTTCAATGGGGCGTCGTTACTGAACGGTATT