Homologs in group_2490

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01615 FBDBKF_01615 89.5 Morganella morganii S1 yobD DUF986 domain-containing protein
EHELCC_02085 EHELCC_02085 89.5 Morganella morganii S2 yobD DUF986 domain-containing protein
NLDBIP_01375 NLDBIP_01375 89.5 Morganella morganii S4 yobD DUF986 domain-containing protein
LHKJJB_00660 LHKJJB_00660 89.5 Morganella morganii S3 yobD DUF986 domain-containing protein
HKOGLL_00700 HKOGLL_00700 89.5 Morganella morganii S5 yobD DUF986 domain-containing protein

Distribution of the homologs in the orthogroup group_2490

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2490

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3L5 8.19e-65 197 65 0 152 3 plu2700 UPF0266 membrane protein plu2700 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JP58 5.21e-61 188 55 0 152 3 YPK_2467 UPF0266 membrane protein YPK_2467 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FJB2 5.21e-61 188 55 0 152 3 YpsIP31758_2371 UPF0266 membrane protein YpsIP31758_2371 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CH34 5.21e-61 188 55 0 152 3 YPN_2368 UPF0266 membrane protein YPN_2368 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFF7 5.21e-61 188 55 0 152 3 YPO1755 UPF0266 membrane protein YPO1755/y2554/YP_1637 Yersinia pestis
B2K0F2 5.21e-61 188 55 0 152 3 YPTS_1754 UPF0266 membrane protein YPTS_1754 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A9R5Y6 5.21e-61 188 55 0 152 3 YpAngola_A1654 UPF0266 membrane protein YpAngola_A1654 Yersinia pestis bv. Antiqua (strain Angola)
Q66BY5 5.21e-61 188 55 0 152 3 YPTB1631 UPF0266 membrane protein YPTB1631 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKE6 5.21e-61 188 55 0 152 3 YPDSF_1369 UPF0266 membrane protein YPDSF_1369 Yersinia pestis (strain Pestoides F)
Q1C8X8 5.21e-61 188 55 0 152 3 YPA_1127 UPF0266 membrane protein YPA_1127 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JM96 1.11e-59 184 56 0 152 3 YE1773 UPF0266 membrane protein YE1773 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GFM7 1.1e-57 179 56 0 152 3 Spro_2816 UPF0266 membrane protein Spro_2816 Serratia proteamaculans (strain 568)
Q6D4K2 2.36e-57 178 57 0 152 3 ECA2388 UPF0266 membrane protein ECA2388 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9MNJ0 4.62e-54 170 49 0 152 3 yobD UPF0266 membrane protein YobD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BHC3 1.13e-52 167 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi A (strain AKU_12601)
Q5PI76 1.13e-52 167 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TY03 2.03e-52 166 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella schwarzengrund (strain CVM19633)
B4TKG4 2.03e-52 166 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella heidelberg (strain SL476)
Q57NH8 2.03e-52 166 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella choleraesuis (strain SC-B67)
Q8ZP01 2.26e-52 166 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4SV74 2.61e-52 166 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella newport (strain SL254)
Q8Z671 3.4e-52 166 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella typhi
A8AFN6 1.22e-51 164 47 0 152 3 CKO_01158 UPF0266 membrane protein CKO_01158 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5R2T8 1.44e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella enteritidis PT4 (strain P125109)
B5F3Q9 1.44e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella agona (strain SL483)
B5FTK0 2.04e-51 163 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella dublin (strain CT_02021853)
A9MVT3 2.49e-51 163 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5YQW1 8.18e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCP5 8.18e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O157:H7
Q3Z2G1 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Shigella sonnei (strain Ss046)
Q32F39 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Shigella dysenteriae serotype 1 (strain Sd197)
B1LD53 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain SMS-3-5 / SECEC)
B6IBP7 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain SE11)
B7NBG6 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P67601 8.27e-51 162 50 0 152 1 yobD UPF0266 membrane protein YobD Escherichia coli (strain K12)
B1J0R8 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P67602 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A117 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O9:H4 (strain HS)
B1XH87 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain K12 / DH10B)
C4ZZH6 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M294 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O8 (strain IAI1)
B7MVK3 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O81 (strain ED1a)
B7NSA1 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L6U8 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain 55989 / EAEC)
A7ZMU2 8.27e-51 162 50 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1RAX0 1.19e-50 161 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain UTI89 / UPEC)
Q0TH13 1.19e-50 161 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABY8 1.19e-50 161 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O1:K1 / APEC
B7MBM6 1.19e-50 161 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7USJ6 2.14e-50 161 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LPM7 2.34e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83L78 4.22e-50 160 50 0 151 3 yobD UPF0266 membrane protein YobD Shigella flexneri
Q0T513 4.22e-50 160 50 0 151 3 yobD UPF0266 membrane protein YobD Shigella flexneri serotype 5b (strain 8401)
Q321Z7 4.22e-50 160 50 0 151 3 yobD UPF0266 membrane protein YobD Shigella boydii serotype 4 (strain Sb227)
A4WBH8 1.99e-49 158 49 0 152 3 Ent638_2389 UPF0266 membrane protein Ent638_2389 Enterobacter sp. (strain 638)
B5XQ53 2.12e-49 158 46 0 152 3 KPK_1957 UPF0266 membrane protein KPK_1957 Klebsiella pneumoniae (strain 342)
C0Q301 3.51e-49 158 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi C (strain RKS4594)
A6TAZ1 1.38e-48 156 46 0 152 3 KPN78578_23010 UPF0266 membrane protein KPN78578_23010 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2U460 2.09e-48 156 48 0 152 3 yobD UPF0266 membrane protein YobD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7MKF9 2.29e-46 150 48 0 152 3 ESA_01432 UPF0266 membrane protein ESA_01432 Cronobacter sakazakii (strain ATCC BAA-894)
C5BDX6 1.14e-44 146 48 0 152 3 NT01EI_1718 UPF0266 membrane protein NT01EI_1718 Edwardsiella ictaluri (strain 93-146)
Q2NTC6 3.17e-44 145 51 1 151 3 SG1324 UPF0266 membrane protein SG1324 Sodalis glossinidius (strain morsitans)
Q9CMJ4 1.29e-25 98 42 4 149 3 PM0830 UPF0266 membrane protein PM0830 Pasteurella multocida (strain Pm70)
A0AGM5 6.27e-24 94 38 1 142 3 lwe0739 UPF0266 membrane protein lwe0739 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q722D6 1.23e-20 85 34 1 142 3 LMOf2365_0797 UPF0266 membrane protein LMOf2365_0797 Listeria monocytogenes serotype 4b (strain F2365)
C1L148 1.23e-20 85 34 1 142 3 Lm4b_00795 UPF0266 membrane protein Lm4b_00795 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y8W3 1.23e-20 85 34 1 142 3 lmo0779 UPF0266 membrane protein lmo0779 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DGI9 1.23e-20 85 34 1 142 3 LMHCC_1856 UPF0266 membrane protein LMHCC_1856 Listeria monocytogenes serotype 4a (strain HCC23)
Q92DP0 3.21e-20 84 34 1 142 3 lin0773 UPF0266 membrane protein lin0773 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03955
Feature type CDS
Gene -
Product DUF986 family protein
Location 839811 - 840269 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2490
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF06173 Protein of unknown function (DUF986)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4811 Function unknown (S) S Uncharacterized membrane protein YobD, UPF0266 family

Protein Sequence

MTINDIILLCVIILMLLFAAYDEFIVNTLKGKTQLRVKLKRNHRADAVIFIFLIGIVIYNNITGHGSALTTYLLSACIIIAIYLAFIRSPKLYFKQDGFFYANAFIKYNRIKTMNLSEDGILLVGLENRKIYIKVSHLDDLQQIYNFMVNNK

Flanking regions ( +/- flanking 50bp)

GAGGAAAACCTCCCGTTTTTTATTGCCGCTTCCGGGGAAAAGAAACCACCATGACTATTAACGATATCATTTTACTGTGTGTAATTATTCTGATGCTGCTGTTTGCGGCCTATGACGAATTTATCGTCAATACACTGAAAGGTAAAACGCAGTTACGGGTCAAACTCAAACGTAACCACCGTGCTGATGCCGTTATTTTCATCTTTCTTATTGGTATTGTTATTTATAATAATATAACCGGACATGGTAGTGCATTAACAACCTATTTACTTTCCGCCTGTATTATCATTGCAATCTATCTGGCTTTTATTCGTTCACCCAAGTTATATTTTAAGCAGGATGGATTCTTTTATGCGAATGCCTTTATTAAATATAATAGAATAAAAACAATGAATTTATCTGAAGACGGCATTCTTCTTGTGGGTTTGGAAAATCGAAAAATCTACATTAAGGTATCTCATCTTGATGATTTACAACAAATTTACAATTTCATGGTTAATAATAAATAATTACCCTTTATTTTTATCCCCCTATAAAAATAAAGACTAATATCAATATT