Homologs in group_2490

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01615 FBDBKF_01615 100.0 Morganella morganii S1 yobD DUF986 domain-containing protein
EHELCC_02085 EHELCC_02085 100.0 Morganella morganii S2 yobD DUF986 domain-containing protein
LHKJJB_00660 LHKJJB_00660 100.0 Morganella morganii S3 yobD DUF986 domain-containing protein
HKOGLL_00700 HKOGLL_00700 100.0 Morganella morganii S5 yobD DUF986 domain-containing protein
F4V73_RS03955 F4V73_RS03955 89.5 Morganella psychrotolerans - DUF986 family protein

Distribution of the homologs in the orthogroup group_2490

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2490

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3L5 4.54e-65 198 66 0 152 3 plu2700 UPF0266 membrane protein plu2700 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JP58 3.96e-64 196 58 0 152 3 YPK_2467 UPF0266 membrane protein YPK_2467 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FJB2 3.96e-64 196 58 0 152 3 YpsIP31758_2371 UPF0266 membrane protein YpsIP31758_2371 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CH34 3.96e-64 196 58 0 152 3 YPN_2368 UPF0266 membrane protein YPN_2368 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFF7 3.96e-64 196 58 0 152 3 YPO1755 UPF0266 membrane protein YPO1755/y2554/YP_1637 Yersinia pestis
B2K0F2 3.96e-64 196 58 0 152 3 YPTS_1754 UPF0266 membrane protein YPTS_1754 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A9R5Y6 3.96e-64 196 58 0 152 3 YpAngola_A1654 UPF0266 membrane protein YpAngola_A1654 Yersinia pestis bv. Antiqua (strain Angola)
Q66BY5 3.96e-64 196 58 0 152 3 YPTB1631 UPF0266 membrane protein YPTB1631 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TKE6 3.96e-64 196 58 0 152 3 YPDSF_1369 UPF0266 membrane protein YPDSF_1369 Yersinia pestis (strain Pestoides F)
Q1C8X8 3.96e-64 196 58 0 152 3 YPA_1127 UPF0266 membrane protein YPA_1127 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JM96 5.99e-63 192 59 0 152 3 YE1773 UPF0266 membrane protein YE1773 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GFM7 2.16e-57 179 55 0 152 3 Spro_2816 UPF0266 membrane protein Spro_2816 Serratia proteamaculans (strain 568)
Q6D4K2 6.38e-57 177 56 0 152 3 ECA2388 UPF0266 membrane protein ECA2388 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9MNJ0 3.07e-53 168 49 0 152 3 yobD UPF0266 membrane protein YobD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BHC3 1.05e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi A (strain AKU_12601)
Q5PI76 1.05e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TY03 1.28e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella schwarzengrund (strain CVM19633)
B4TKG4 1.28e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella heidelberg (strain SL476)
Q57NH8 1.28e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella choleraesuis (strain SC-B67)
Q8ZP01 1.41e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4SV74 1.73e-51 164 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella newport (strain SL254)
Q8Z671 2.28e-51 163 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella typhi
B5R2T8 8.46e-51 162 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella enteritidis PT4 (strain P125109)
B5F3Q9 8.46e-51 162 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella agona (strain SL483)
B5FTK0 1.28e-50 161 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella dublin (strain CT_02021853)
A9MVT3 1.35e-50 161 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A8AFN6 2.5e-50 160 46 0 152 3 CKO_01158 UPF0266 membrane protein CKO_01158 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3Z2G1 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Shigella sonnei (strain Ss046)
Q32F39 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Shigella dysenteriae serotype 1 (strain Sd197)
B1LD53 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain SMS-3-5 / SECEC)
B6IBP7 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain SE11)
B7NBG6 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P67601 3.91e-50 160 49 0 152 1 yobD UPF0266 membrane protein YobD Escherichia coli (strain K12)
B1J0R8 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P67602 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A117 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O9:H4 (strain HS)
B1XH87 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain K12 / DH10B)
C4ZZH6 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M294 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O8 (strain IAI1)
B7MVK3 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O81 (strain ED1a)
B7NSA1 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L6U8 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain 55989 / EAEC)
A7ZMU2 3.91e-50 160 49 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O139:H28 (strain E24377A / ETEC)
B5XQ53 4.7e-50 160 48 0 152 3 KPK_1957 UPF0266 membrane protein KPK_1957 Klebsiella pneumoniae (strain 342)
B7LPM7 4.91e-50 160 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RAX0 5.36e-50 160 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli (strain UTI89 / UPEC)
Q0TH13 5.36e-50 160 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABY8 5.36e-50 160 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O1:K1 / APEC
B7MBM6 5.36e-50 160 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O45:K1 (strain S88 / ExPEC)
B5YQW1 8.96e-50 159 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCP5 8.96e-50 159 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O157:H7
B7USJ6 1e-49 159 48 0 152 3 yobD UPF0266 membrane protein YobD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q83L78 1.75e-49 159 49 0 151 3 yobD UPF0266 membrane protein YobD Shigella flexneri
Q0T513 1.75e-49 159 49 0 151 3 yobD UPF0266 membrane protein YobD Shigella flexneri serotype 5b (strain 8401)
Q321Z7 1.75e-49 159 49 0 151 3 yobD UPF0266 membrane protein YobD Shigella boydii serotype 4 (strain Sb227)
A4WBH8 2.09e-48 156 49 0 152 3 Ent638_2389 UPF0266 membrane protein Ent638_2389 Enterobacter sp. (strain 638)
C0Q301 3.68e-48 155 48 0 152 3 yobD UPF0266 membrane protein YobD Salmonella paratyphi C (strain RKS4594)
B2U460 7.01e-48 154 48 0 152 3 yobD UPF0266 membrane protein YobD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TAZ1 1.24e-47 154 47 0 152 3 KPN78578_23010 UPF0266 membrane protein KPN78578_23010 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C5BDX6 4.42e-45 147 48 0 152 3 NT01EI_1718 UPF0266 membrane protein NT01EI_1718 Edwardsiella ictaluri (strain 93-146)
A7MKF9 1.9e-44 146 44 0 152 3 ESA_01432 UPF0266 membrane protein ESA_01432 Cronobacter sakazakii (strain ATCC BAA-894)
Q2NTC6 3.28e-44 145 53 1 151 3 SG1324 UPF0266 membrane protein SG1324 Sodalis glossinidius (strain morsitans)
Q9CMJ4 4.53e-25 96 42 1 130 3 PM0830 UPF0266 membrane protein PM0830 Pasteurella multocida (strain Pm70)
A0AGM5 1.55e-23 92 37 1 143 3 lwe0739 UPF0266 membrane protein lwe0739 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q722D6 7.41e-23 91 34 1 142 3 LMOf2365_0797 UPF0266 membrane protein LMOf2365_0797 Listeria monocytogenes serotype 4b (strain F2365)
C1L148 7.41e-23 91 34 1 142 3 Lm4b_00795 UPF0266 membrane protein Lm4b_00795 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y8W3 7.41e-23 91 34 1 142 3 lmo0779 UPF0266 membrane protein lmo0779 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DGI9 7.41e-23 91 34 1 142 3 LMHCC_1856 UPF0266 membrane protein LMHCC_1856 Listeria monocytogenes serotype 4a (strain HCC23)
Q92DP0 2.07e-20 84 33 1 142 3 lin0773 UPF0266 membrane protein lin0773 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_01375
Feature type CDS
Gene yobD
Product DUF986 domain-containing protein
Location 275112 - 275570 (strand: 1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2490
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF06173 Protein of unknown function (DUF986)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4811 Function unknown (S) S Uncharacterized membrane protein YobD, UPF0266 family

Protein Sequence

MSVNDIVLLAVIVLMLLFAVYDEFIVNTLKGKTQLRIKLRRNHRADAVIFILLIGIVIYNNITGHGSPLTTYLLSGCIIIAIYLAFIRSPKLYFKQDGFFYANAYIKYDRIKTMNLSEDGILLVGLENRKIYIKVTHLDDLQKIYNFMINNK

Flanking regions ( +/- flanking 50bp)

GGGAGGCTCGCCTCCCGTTTTCTGTTTCACTTCAGGGGAAAAGAACCACAATGAGTGTAAATGATATTGTTCTGCTGGCTGTGATTGTGCTGATGCTGCTGTTTGCCGTCTACGACGAATTTATTGTTAACACACTGAAAGGCAAAACACAGCTGCGGATAAAACTGCGCCGTAATCACCGCGCTGACGCTGTGATCTTTATCCTTCTTATCGGTATTGTTATTTATAATAATATAACCGGACACGGCAGCCCGTTAACAACTTATTTACTTTCCGGCTGTATTATCATTGCTATTTATCTGGCTTTTATACGTTCACCGAAGTTATATTTTAAGCAGGACGGATTTTTTTACGCCAATGCATATATTAAATATGACAGAATAAAAACAATGAATTTATCAGAAGACGGTATTCTTCTTGTGGGTTTGGAAAATCGTAAAATTTACATCAAAGTCACGCATCTTGATGATTTACAAAAAATTTATAATTTTATGATTAATAACAAATAATAACCCCTTCTTTTTATCCCCCTACAGAAATAAAGACTAATGATGATATT