Homologs in group_1840

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13630 FBDBKF_13630 84.6 Morganella morganii S1 arsC arsenate reductase (glutaredoxin)
EHELCC_08465 EHELCC_08465 84.6 Morganella morganii S2 arsC arsenate reductase (glutaredoxin)
NLDBIP_08790 NLDBIP_08790 84.6 Morganella morganii S4 arsC arsenate reductase (glutaredoxin)
LHKJJB_05475 LHKJJB_05475 84.6 Morganella morganii S3 arsC arsenate reductase (glutaredoxin)
HKOGLL_05440 HKOGLL_05440 84.6 Morganella morganii S5 arsC arsenate reductase (glutaredoxin)
PMI_RS07645 PMI_RS07645 70.3 Proteus mirabilis HI4320 arsC arsenate reductase (glutaredoxin)

Distribution of the homologs in the orthogroup group_1840

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1840

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76569 2.51e-45 145 63 3 119 1 yfgD Uncharacterized protein YfgD Escherichia coli (strain K12)
P44589 1.19e-36 123 52 1 115 3 arsC Arsenate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P63622 6.22e-30 106 46 1 110 3 arsC Arsenate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63621 6.22e-30 106 46 1 110 3 arsC Arsenate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P95354 1.9e-26 97 44 1 99 3 arsC Putative arsenate reductase Neisseria gonorrhoeae
P52147 5.01e-22 87 43 2 114 3 arsC Arsenate reductase Escherichia coli
Q92R44 4.31e-21 85 42 2 115 1 arsC Arsenate reductase Rhizobium meliloti (strain 1021)
P08692 1.52e-20 83 41 2 115 1 arsC Arsenate reductase Escherichia coli
P0AB97 1.64e-20 83 42 2 114 3 arsC Arsenate reductase Shigella flexneri
P0AB96 1.64e-20 83 42 2 114 2 arsC Arsenate reductase Escherichia coli (strain K12)
P74984 2.34e-20 83 42 2 114 3 arsC Arsenate reductase Yersinia enterocolitica
O50595 5.23e-19 79 41 2 115 3 arsC Arsenate reductase Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU 301)
P19434 1.93e-16 72 36 3 117 3 None Uncharacterized protein in glnII region Streptomyces viridochromogenes
Q6ZEM6 5.35e-14 67 35 2 117 1 arsI1 Arsenate reductase ArsI1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6YRW7 5.52e-14 66 35 2 115 1 arsI2 Arsenate reductase ArsI2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0CF86 2.64e-07 48 32 1 84 3 yfjU Putative arsenate reductase-like protein Escherichia coli (strain K12)
P0CF87 2.64e-07 48 32 1 84 3 yfjU Putative arsenate reductase Escherichia coli (strain K12)
P60380 1.85e-06 47 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MW2)
Q6GAS9 1.85e-06 47 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MSSA476)
Q6GI88 1.85e-06 47 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MRSA252)
P60379 1.85e-06 47 27 4 112 1 spx Global transcriptional regulator Spx Staphylococcus aureus (strain N315)
P60378 1.85e-06 47 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH87 1.85e-06 47 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain COL)
Q2G1U6 1.85e-06 47 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8CT68 2.73e-06 46 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQH3 2.73e-06 46 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O32175 5.46e-06 45 26 2 115 3 yusI Uncharacterized protein YusI Bacillus subtilis (strain 168)
Q4L505 6.1e-06 45 27 4 112 3 spx Global transcriptional regulator Spx Staphylococcus haemolyticus (strain JCSC1435)
Q49WC6 6.71e-06 45 25 2 110 3 spx Global transcriptional regulator Spx Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O31602 6.99e-06 45 29 6 107 1 spx Global transcriptional regulator Spx Bacillus subtilis (strain 168)
Q8ERT7 1.12e-05 44 27 4 105 3 spx1 Global transcriptional regulator Spx 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RGX0 2.11e-05 43 25 2 104 3 spx Global transcriptional regulator Spx Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XH4 2.11e-05 43 25 2 104 3 spx Global transcriptional regulator Spx Listeria monocytogenes serotype 4b (strain F2365)
P60377 2.11e-05 43 25 2 104 3 spx Global transcriptional regulator Spx Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P54503 4.19e-05 43 23 2 117 1 mgsR Regulatory protein MgsR Bacillus subtilis (strain 168)
Q5WEZ7 5.62e-05 43 25 2 104 3 spx Global transcriptional regulator Spx Shouchella clausii (strain KSM-K16)
Q9K8Z1 7.44e-05 42 24 2 104 3 spx Global transcriptional regulator Spx Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8DPA8 0.000131 42 26 4 105 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q26 0.000131 42 26 4 105 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8ERE2 0.000746 40 21 3 115 3 spx2 Global transcriptional regulator Spx 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q830U3 0.000873 39 23 3 105 3 spx Global transcriptional regulator Spx Enterococcus faecalis (strain ATCC 700802 / V583)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03120
Feature type CDS
Gene arsC
Product arsenate reductase (glutaredoxin)
Location 667037 - 667393 (strand: -1)
Length 357 (nucleotides) / 118 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1840
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00537 arsenate reductase (glutaredoxin) [EC:1.20.4.1] - -

Protein Sequence

MTDTVTIWHNPRCSKSRETLALLEAHGVTPAVILYLDTAPSVAEIKNLLKKLTFDDARLLMRTKEAIYSELGLADVTSQDALIQAMHDNPKLIERPVVVNGKLARLGRPPEQVLEIIN

Flanking regions ( +/- flanking 50bp)

GCCAGTTACAGATGCAATTCAAACAATTTAAATAATCAATGAGGAAAACCATGACAGACACAGTCACCATCTGGCATAACCCGCGCTGCTCCAAGAGCCGCGAAACCCTCGCATTGCTGGAAGCGCACGGAGTAACACCTGCGGTGATTCTCTATCTGGACACCGCCCCCTCTGTTGCAGAGATTAAAAACCTGCTTAAAAAGCTGACATTTGATGATGCCCGCCTGCTGATGCGTACCAAAGAAGCAATTTACAGCGAATTGGGTCTGGCAGACGTCACGAGCCAGGATGCATTAATTCAGGCAATGCATGACAATCCGAAACTCATTGAGCGCCCTGTTGTCGTTAACGGGAAGCTTGCCCGTTTGGGTCGCCCACCGGAGCAGGTGCTGGAAATTATTAACTAAACGGTTGTCCATCCCCCGGCAATTATCCCGGGGGATATTTTCTGATGCGC