Homologs in group_1877

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13630 FBDBKF_13630 100.0 Morganella morganii S1 arsC arsenate reductase (glutaredoxin)
EHELCC_08465 EHELCC_08465 100.0 Morganella morganii S2 arsC arsenate reductase (glutaredoxin)
NLDBIP_08790 NLDBIP_08790 100.0 Morganella morganii S4 arsC arsenate reductase (glutaredoxin)
HKOGLL_05440 HKOGLL_05440 100.0 Morganella morganii S5 arsC arsenate reductase (glutaredoxin)
F4V73_RS03120 F4V73_RS03120 84.6 Morganella psychrotolerans arsC arsenate reductase (glutaredoxin)
PMI_RS07645 PMI_RS07645 65.0 Proteus mirabilis HI4320 arsC arsenate reductase (glutaredoxin)

Distribution of the homologs in the orthogroup group_1877

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1877

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76569 5.69e-46 147 61 1 118 1 yfgD Uncharacterized protein YfgD Escherichia coli (strain K12)
P44589 1.35e-35 120 49 1 115 3 arsC Arsenate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P63622 1.05e-32 113 48 1 110 3 arsC Arsenate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63621 1.05e-32 113 48 1 110 3 arsC Arsenate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P95354 4.62e-28 101 48 2 100 3 arsC Putative arsenate reductase Neisseria gonorrhoeae
P52147 1e-21 86 41 3 116 3 arsC Arsenate reductase Escherichia coli
Q92R44 3.9e-21 85 40 2 115 1 arsC Arsenate reductase Rhizobium meliloti (strain 1021)
P74984 2.17e-20 83 40 2 114 3 arsC Arsenate reductase Yersinia enterocolitica
P0AB97 2.75e-20 82 40 3 116 3 arsC Arsenate reductase Shigella flexneri
P0AB96 2.75e-20 82 40 3 116 2 arsC Arsenate reductase Escherichia coli (strain K12)
P08692 2.75e-20 82 39 3 116 1 arsC Arsenate reductase Escherichia coli
O50595 1.05e-18 79 39 3 116 3 arsC Arsenate reductase Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU 301)
P19434 1.12e-12 62 36 3 112 3 None Uncharacterized protein in glnII region Streptomyces viridochromogenes
Q6ZEM6 6.99e-11 58 32 2 116 1 arsI1 Arsenate reductase ArsI1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6YRW7 8.44e-11 58 33 2 114 1 arsI2 Arsenate reductase ArsI2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0CF86 5.79e-10 55 32 1 84 3 yfjU Putative arsenate reductase-like protein Escherichia coli (strain K12)
P0CF87 5.79e-10 55 32 1 84 3 yfjU Putative arsenate reductase Escherichia coli (strain K12)
Q9K8Z1 6.2e-06 45 27 3 105 3 spx Global transcriptional regulator Spx Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O31602 7.03e-06 45 26 3 105 1 spx Global transcriptional regulator Spx Bacillus subtilis (strain 168)
Q5WEZ7 8.94e-06 45 28 3 105 3 spx Global transcriptional regulator Spx Shouchella clausii (strain KSM-K16)
Q8ERT7 1.03e-05 45 25 3 112 3 spx1 Global transcriptional regulator Spx 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RGX0 1.07e-05 44 25 3 114 3 spx Global transcriptional regulator Spx Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XH4 1.07e-05 44 25 3 114 3 spx Global transcriptional regulator Spx Listeria monocytogenes serotype 4b (strain F2365)
P60377 1.07e-05 44 25 3 114 3 spx Global transcriptional regulator Spx Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q81GK7 1.34e-05 44 25 3 111 3 spx1 Global transcriptional regulator Spx 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TR6 1.34e-05 44 25 3 111 3 spx1 Global transcriptional regulator Spx 1 Bacillus anthracis
O32175 5.7e-05 42 26 2 115 3 yusI Uncharacterized protein YusI Bacillus subtilis (strain 168)
Q49WC6 7.88e-05 42 24 3 111 3 spx Global transcriptional regulator Spx Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P60380 9.02e-05 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MW2)
Q6GAS9 9.02e-05 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MSSA476)
Q6GI88 9.02e-05 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MRSA252)
P60379 9.02e-05 42 23 3 111 1 spx Global transcriptional regulator Spx Staphylococcus aureus (strain N315)
P60378 9.02e-05 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH87 9.02e-05 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain COL)
Q2G1U6 9.02e-05 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8CT68 0.000141 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQH3 0.000141 42 23 3 111 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L505 0.000279 41 23 3 113 3 spx Global transcriptional regulator Spx Staphylococcus haemolyticus (strain JCSC1435)
Q830U3 0.00052 40 23 3 105 3 spx Global transcriptional regulator Spx Enterococcus faecalis (strain ATCC 700802 / V583)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05475
Feature type CDS
Gene arsC
Product arsenate reductase (glutaredoxin)
Location 86427 - 86780 (strand: 1)
Length 354 (nucleotides) / 117 (amino acids)
In genomic island -

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1877
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00537 arsenate reductase (glutaredoxin) [EC:1.20.4.1] - -

Protein Sequence

MTDTVTIWHNPRCSKSRETLALLEENGVSPAVMLYLDTPPSVADIKTVLRELKFDDARKLMRTKEALYSELGLAAVTDQDALIQAMHDNPKLIERPVVIKGKQARLGRPPEQVLEII

Flanking regions ( +/- flanking 50bp)

ATCCGCCAGTTACAGCTGCAATTCAAACAATTTAAATGATGAGGGAAACCATGACTGATACTGTTACCATCTGGCACAACCCGCGCTGCTCCAAAAGCCGTGAAACTCTGGCACTGCTGGAAGAAAACGGCGTGTCTCCTGCAGTAATGCTCTATCTGGACACTCCGCCGTCAGTAGCGGACATCAAAACCGTGCTTCGTGAGCTGAAATTTGATGACGCCCGCAAACTGATGCGCACCAAAGAAGCCCTTTACAGTGAGCTGGGACTGGCGGCGGTCACTGATCAGGATGCACTGATTCAGGCCATGCATGACAACCCGAAGCTGATTGAACGCCCTGTGGTGATTAAAGGCAAACAAGCCCGTCTCGGCCGTCCGCCGGAGCAGGTGCTGGAGATTATCTGAACCTGATCATCTGTCCCCGGTGACCGCCGGGGACAGAGCTCAGAATTGCC