Homologs in group_1840

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13630 FBDBKF_13630 65.0 Morganella morganii S1 arsC arsenate reductase (glutaredoxin)
EHELCC_08465 EHELCC_08465 65.0 Morganella morganii S2 arsC arsenate reductase (glutaredoxin)
NLDBIP_08790 NLDBIP_08790 65.0 Morganella morganii S4 arsC arsenate reductase (glutaredoxin)
LHKJJB_05475 LHKJJB_05475 65.0 Morganella morganii S3 arsC arsenate reductase (glutaredoxin)
HKOGLL_05440 HKOGLL_05440 65.0 Morganella morganii S5 arsC arsenate reductase (glutaredoxin)
F4V73_RS03120 F4V73_RS03120 70.3 Morganella psychrotolerans arsC arsenate reductase (glutaredoxin)

Distribution of the homologs in the orthogroup group_1840

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1840

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76569 9.24e-45 144 62 1 114 1 yfgD Uncharacterized protein YfgD Escherichia coli (strain K12)
P44589 6.86e-35 119 52 1 114 3 arsC Arsenate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P63622 4e-32 112 46 1 115 3 arsC Arsenate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63621 4e-32 112 46 1 115 3 arsC Arsenate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P95354 5.66e-26 96 44 1 98 3 arsC Putative arsenate reductase Neisseria gonorrhoeae
P0AB97 7.27e-23 89 45 3 114 3 arsC Arsenate reductase Shigella flexneri
P0AB96 7.27e-23 89 45 3 114 2 arsC Arsenate reductase Escherichia coli (strain K12)
P74984 2.88e-22 87 46 3 114 3 arsC Arsenate reductase Yersinia enterocolitica
P52147 2.91e-22 87 46 3 114 3 arsC Arsenate reductase Escherichia coli
Q92R44 5.44e-22 87 45 2 110 1 arsC Arsenate reductase Rhizobium meliloti (strain 1021)
O50595 1.27e-21 86 45 3 114 3 arsC Arsenate reductase Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU 301)
P08692 2.14e-21 85 42 3 119 1 arsC Arsenate reductase Escherichia coli
Q6ZEM6 1.12e-14 68 36 2 116 1 arsI1 Arsenate reductase ArsI1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6YRW7 6.41e-14 66 35 2 114 1 arsI2 Arsenate reductase ArsI2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P19434 2.79e-12 61 35 3 112 3 None Uncharacterized protein in glnII region Streptomyces viridochromogenes
P0CF86 1.01e-09 54 38 0 70 3 yfjU Putative arsenate reductase-like protein Escherichia coli (strain K12)
P0CF87 1.01e-09 54 38 0 70 3 yfjU Putative arsenate reductase Escherichia coli (strain K12)
P54503 6.14e-09 53 28 2 119 1 mgsR Regulatory protein MgsR Bacillus subtilis (strain 168)
O32175 9.34e-08 50 28 2 112 3 yusI Uncharacterized protein YusI Bacillus subtilis (strain 168)
O31602 2.46e-07 49 26 2 104 1 spx Global transcriptional regulator Spx Bacillus subtilis (strain 168)
Q8ERT7 2.73e-06 46 25 2 104 3 spx1 Global transcriptional regulator Spx 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q830U3 9.61e-06 45 24 2 104 3 spx Global transcriptional regulator Spx Enterococcus faecalis (strain ATCC 700802 / V583)
Q9RGX0 1.17e-05 44 25 2 104 3 spx Global transcriptional regulator Spx Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XH4 1.17e-05 44 25 2 104 3 spx Global transcriptional regulator Spx Listeria monocytogenes serotype 4b (strain F2365)
P60377 1.17e-05 44 25 2 104 3 spx Global transcriptional regulator Spx Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DPA8 2.37e-05 43 26 4 115 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q26 2.37e-05 43 26 4 115 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q81GK7 3.24e-05 43 23 2 104 3 spx1 Global transcriptional regulator Spx 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TR6 3.24e-05 43 23 2 104 3 spx1 Global transcriptional regulator Spx 1 Bacillus anthracis
Q8DU17 7.52e-05 42 22 2 114 1 spx Global transcriptional regulator Spx Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8ERE2 9.19e-05 42 25 3 104 3 spx2 Global transcriptional regulator Spx 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P60376 0.000112 42 24 2 114 3 spx Global transcriptional regulator Spx Lactococcus lactis subsp. cremoris (strain MG1363)
P60375 0.000112 42 24 2 114 3 spx2 Global transcriptional regulator Spx 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q5XBX9 0.000283 41 21 2 114 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5WEZ7 0.000286 41 24 2 104 3 spx Global transcriptional regulator Spx Shouchella clausii (strain KSM-K16)
Q8DZV0 0.000319 41 20 3 116 3 spx Global transcriptional regulator Spx Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5J8 0.000319 41 20 3 116 3 spx Global transcriptional regulator Spx Streptococcus agalactiae serotype III (strain NEM316)
Q9K8Z1 0.000341 40 22 2 104 3 spx Global transcriptional regulator Spx Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q81MW4 0.000614 40 23 2 110 3 spx2 Global transcriptional regulator Spx 2 Bacillus anthracis
P60382 0.001 39 21 2 114 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M18 (strain MGAS8232)
P60381 0.001 39 21 2 114 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M1

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07645
Feature type CDS
Gene arsC
Product arsenate reductase (glutaredoxin)
Location 1667116 - 1667472 (strand: 1)
Length 357 (nucleotides) / 118 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1840
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00537 arsenate reductase (glutaredoxin) [EC:1.20.4.1] - -

Protein Sequence

MTNKVTIYHNPRCSKSRETLHLLEDMHITPDVIHYLDTPPSVDELKALLKALDFDDARKLMRTKEEIYKTLKLADESSQEALIQAMHNHPKLIERPIVVVGNKARLGRPPEQVTALFK

Flanking regions ( +/- flanking 50bp)

CAATTGCGTAAACTTCAACATAAAGACAGTCAATTTAAATAAGGGATAATATGACCAACAAAGTAACGATTTATCATAATCCGCGCTGTTCTAAAAGCCGTGAAACCTTACATTTATTAGAAGATATGCATATCACCCCTGACGTTATTCATTATTTAGATACGCCGCCTTCTGTTGATGAGTTAAAAGCATTACTCAAAGCGCTAGATTTTGACGATGCAAGAAAATTAATGCGCACCAAAGAAGAAATTTATAAAACCCTAAAGCTTGCTGATGAGAGCTCACAAGAAGCATTAATTCAGGCCATGCATAATCATCCTAAATTAATTGAACGTCCTATTGTGGTCGTTGGCAATAAAGCGCGTTTAGGTCGTCCACCTGAGCAAGTTACCGCCCTTTTTAAGTAGGCTAAATTGGCAATTGCCGACATTGACGGTATGGCGCATCACTAAAACGT