Homologs in group_26

Help

16 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12005 FBDBKF_12005 31.0 Morganella morganii S1 - Filamentous hemagglutinin
FBDBKF_16585 FBDBKF_16585 67.8 Morganella morganii S1 - Hemolysin
EHELCC_08450 EHELCC_08450 67.8 Morganella morganii S2 - Hemolysin
EHELCC_14300 EHELCC_14300 31.0 Morganella morganii S2 - Filamentous hemagglutinin
NLDBIP_08775 NLDBIP_08775 67.8 Morganella morganii S4 - Hemolysin
NLDBIP_15395 NLDBIP_15395 31.0 Morganella morganii S4 - Filamentous hemagglutinin
LHKJJB_05490 LHKJJB_05490 67.8 Morganella morganii S3 - Hemolysin
LHKJJB_15215 LHKJJB_15215 31.0 Morganella morganii S3 - Filamentous hemagglutinin
HKOGLL_05425 HKOGLL_05425 67.8 Morganella morganii S5 - Hemolysin
HKOGLL_14335 HKOGLL_14335 31.0 Morganella morganii S5 - Filamentous hemagglutinin
F4V73_RS03085 F4V73_RS03085 38.4 Morganella psychrotolerans - filamentous hemagglutinin N-terminal domain-containing protein
F4V73_RS14650 F4V73_RS14650 29.9 Morganella psychrotolerans - filamentous hemagglutinin N-terminal domain-containing protein
PMI_RS03490 PMI_RS03490 22.0 Proteus mirabilis HI4320 - filamentous hemagglutinin N-terminal domain-containing protein
PMI_RS08095 PMI_RS08095 25.4 Proteus mirabilis HI4320 - filamentous hemagglutinin N-terminal domain-containing protein
PMI_RS14040 PMI_RS14040 28.4 Proteus mirabilis HI4320 - filamentous hemagglutinin N-terminal domain-containing protein
PMI_RS14405 PMI_RS14405 25.9 Proteus mirabilis HI4320 - filamentous hemagglutinin N-terminal domain-containing protein

Distribution of the homologs in the orthogroup group_26

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_26

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
D5CBA0 1.15e-15 77 36 2 116 1 cdiA 16S rRNA endonuclease CdiA Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
Q3YL96 1.05e-14 74 37 2 116 1 cdiA Toxin CdiA Escherichia coli
A0A1S4NYE3 4.42e-14 73 37 2 116 1 cdiA tRNA nuclease CdiA Escherichia coli (strain STEC_O31)
Q0T963 5.56e-14 72 37 2 116 1 cdiA tRNA nuclease CdiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B3BM48 6.12e-14 72 37 2 116 1 cdiA1 tRNA nuclease CdiA Escherichia coli O157:H7 (strain EC869)
P0DSI1 1.58e-13 71 36 2 116 1 cdiA tRNA nuclease CdiA Escherichia coli (strain NC101)
C4SGN7 2.34e-10 62 28 1 127 3 cdiA tRNA nuclease CdiA Yersinia mollaretii (strain ATCC 43969 / DSM 18520 / CIP 103324 / CNY 7263 / WAIP 204)
P16466 1.31e-09 60 32 1 99 1 hpmA Hemolysin Proteus mirabilis
P15320 1.91e-08 56 31 2 101 1 shlA Hemolysin Serratia marcescens
P12255 2.5e-08 56 28 1 112 1 fhaB Filamentous hemagglutinin Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7CGD9 5.71e-07 52 26 1 110 3 cdiA Toxin CdiA Yersinia pestis
Q06277 3.45e-06 50 28 2 109 1 ibpA Protein adenylyltransferase and cysteine protease IbpA Histophilus somni (strain 2336)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03115
Feature type CDS
Gene -
Product filamentous hemagglutinin N-terminal domain-containing protein
Location 666326 - 666877 (strand: -1)
Length 552 (nucleotides) / 183 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_26
Orthogroup size 17
N. genomes 7

Actions

Genomic region

Domains

PF05860 TPS secretion domain

Protein Sequence

MKKTLAALSFISVAAFSAHSVAGPGEMEYTYRNGEKIRVVSPDAQTSLFEDTSGKPVLEINSPNNRGISHNIFEEYNVGRKGLTIINNENAATIINEVIGNKVTNLWGNTHIAGGKASLLIVNPNGVNCHGCTSTGTTIYTHRKTLPVLVNSLNKKTIFRGVIPAKASDRLTDIRHNISFSAP

Flanking regions ( +/- flanking 50bp)

ACATTTTGCTCAGTTAACACTGCTCAACAAAATGATTAAAGGAATCAATCATGAAAAAGACATTAGCTGCATTATCATTCATCTCAGTTGCTGCATTTTCTGCTCACTCTGTAGCAGGTCCGGGAGAAATGGAATATACCTACCGGAATGGCGAAAAAATACGTGTGGTAAGCCCGGATGCACAGACTTCACTGTTTGAAGATACGTCCGGAAAGCCCGTCTTAGAGATTAACTCACCAAATAACCGTGGCATATCTCATAATATATTTGAAGAATATAATGTTGGACGTAAAGGTTTAACCATCATTAATAATGAAAATGCGGCCACCATTATCAATGAAGTTATCGGCAATAAAGTCACCAATTTATGGGGAAATACCCACATCGCAGGAGGCAAAGCCAGCTTGCTGATTGTCAATCCGAACGGCGTAAACTGCCACGGTTGCACCTCAACCGGTACAACAATTTATACTCACCGTAAAACGCTGCCTGTCCTGGTCAATTCATTGAATAAAAAGACAATATTCCGTGGTGTGATACCGGCGAAAGCATCAGACAGACTCACAGATATCCGCCATAATATTTCATTCTCAGCACCGTAATAACCACTATCCTGCTGCGGGTTATACCGCAGCAATGCTTCCCTTATCTG