Homologs in group_374

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14075 FBDBKF_14075 95.1 Morganella morganii S1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
EHELCC_08205 EHELCC_08205 95.1 Morganella morganii S2 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
NLDBIP_08530 NLDBIP_08530 95.1 Morganella morganii S4 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
LHKJJB_05735 LHKJJB_05735 95.1 Morganella morganii S3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
HKOGLL_05180 HKOGLL_05180 95.1 Morganella morganii S5 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
PMI_RS08555 PMI_RS08555 89.5 Proteus mirabilis HI4320 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
PMI_RS13095 PMI_RS13095 29.8 Proteus mirabilis HI4320 caiD crotonobetainyl-CoA hydratase

Distribution of the homologs in the orthogroup group_374

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_374

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQ56 0.0 531 87 0 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ABU0 0.0 526 86 0 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Escherichia coli (strain K12)
P0ABU1 0.0 526 86 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9CLV5 0.0 522 85 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Pasteurella multocida (strain Pm70)
P44960 0.0 520 83 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23966 1.75e-134 384 68 2 264 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Bacillus subtilis (strain 168)
Q49WG8 1.18e-130 374 68 2 265 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L549 3.19e-128 368 66 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus haemolyticus (strain JCSC1435)
Q5HQC3 1.17e-127 367 67 1 254 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CPQ4 1.48e-127 366 67 1 254 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8NXA0 1.03e-126 364 65 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MW2)
Q6GAG7 1.03e-126 364 65 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MSSA476)
Q6GI37 1.73e-126 363 65 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MRSA252)
Q5HH38 1.73e-126 363 65 1 262 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain COL)
Q7A6A9 2.81e-126 363 65 1 262 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain N315)
Q99V48 2.81e-126 363 65 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8GYN9 5.02e-125 362 65 2 266 1 MENB 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal Arabidopsis thaliana
Q9TM10 2.47e-115 335 60 2 261 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Cyanidium caldarium
P9WNP5 3.13e-79 245 47 5 286 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNP4 3.13e-79 245 47 5 286 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0QRD3 5.86e-79 244 47 6 296 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A4YI89 6.67e-34 127 33 5 248 1 Msed_2001 3-hydroxypropionyl-coenzyme A dehydratase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
P9WNN9 1.11e-33 126 36 6 261 1 echA8 Probable enoyl-CoA hydratase EchA8 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN8 1.11e-33 126 36 6 261 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64017 1.11e-33 126 36 6 261 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1ZXF1 1.25e-33 126 35 5 248 3 echs1 Probable enoyl-CoA hydratase, mitochondrial Dictyostelium discoideum
P52046 1.93e-32 123 31 5 263 1 crt Short-chain-enoyl-CoA hydratase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O34893 5.2e-32 122 32 5 256 3 yngF Putative enoyl-CoA hydratase/isomerase YngF Bacillus subtilis (strain 168)
Q0AVM1 2.61e-31 120 32 5 262 1 Swol_1936 Crotonyl-CoA hydratase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q8BH95 1.32e-30 119 32 6 274 1 Echs1 Enoyl-CoA hydratase, mitochondrial Mus musculus
P14604 1.69e-30 119 35 5 245 1 Echs1 Enoyl-CoA hydratase, mitochondrial Rattus norvegicus
O07137 1.8e-30 117 35 5 246 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium leprae (strain TN)
Q86YB7 4.24e-30 117 32 5 253 1 ECHDC2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Homo sapiens
Q3TLP5 4.66e-30 117 31 5 257 1 Echdc2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Mus musculus
P30084 4.91e-30 117 33 5 245 1 ECHS1 Enoyl-CoA hydratase, mitochondrial Homo sapiens
Q5SKU3 5.67e-30 116 33 7 253 1 TTHA0550 Putative enoyl-CoA hydratase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q2TBT3 3.14e-29 115 32 4 253 2 ECHDC2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Bos taurus
P34559 8.32e-29 114 31 4 251 3 ech-6 Probable enoyl-CoA hydratase, mitochondrial Caenorhabditis elegans
Q5R646 1.37e-28 114 33 5 245 2 ECHS1 Enoyl-CoA hydratase, mitochondrial Pongo abelii
Q9KJE7 2.57e-28 112 30 5 255 1 bbsH (E)-benzylidenesuccinyl-CoA hydratase Thauera aromatica
O69762 2.71e-28 112 36 5 211 1 None Hydroxycinnamoyl-CoA hydratase-lyase Pseudomonas fluorescens
G4V4T7 5.06e-28 111 32 5 265 1 dpgD Enoyl-CoA-hydratase Amycolatopsis orientalis
Q58DM8 4.85e-27 109 33 5 245 2 ECHS1 Enoyl-CoA hydratase, mitochondrial Bos taurus
P76082 5.16e-27 108 31 7 247 1 paaF 2,3-dehydroadipyl-CoA hydratase Escherichia coli (strain K12)
Q52995 8.28e-25 102 32 8 263 3 fadB1 Probable enoyl-CoA hydratase Rhizobium meliloti (strain 1021)
F4JML5 9.84e-25 103 27 3 252 2 At4g16800 Probable enoyl-CoA hydratase 2, mitochondrial Arabidopsis thaliana
Q96DC8 1.47e-24 103 32 5 253 1 ECHDC3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Homo sapiens
Q39TV7 1.73e-24 104 35 1 173 1 bamA 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3MIE0 2.82e-23 99 30 4 252 2 Echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Rattus norvegicus
Q8Z9L5 3.87e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella typhi
B4T6J5 5.06e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella newport (strain SL254)
Q9D7J9 8.06e-23 98 30 4 252 1 Echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Mus musculus
P9WNP1 1.27e-22 96 29 6 250 1 echA6 Probable enoyl-CoA hydratase EchA6 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNP0 1.27e-22 96 29 6 250 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64015 1.27e-22 96 29 6 250 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q73VC7 2.31e-22 96 31 5 211 3 echA17 Probable enoyl-CoA hydratase echA17 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJH8 2.9e-22 96 30 5 216 3 echA17 Probable enoyl-CoA hydratase echA17 Mycobacterium avium (strain 104)
Q4PEN0 3.23e-22 96 26 5 257 1 fer4 Enoyl-CoA isomerase/hydratase fer4 Ustilago maydis (strain 521 / FGSC 9021)
Q8ZRX5 3.84e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWR3 3.84e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella schwarzengrund (strain CVM19633)
B4TIG9 3.84e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella heidelberg (strain SL476)
A5JTM5 4.73e-22 95 33 4 208 1 None 4-chlorobenzoyl coenzyme A dehalogenase Pseudomonas sp. (strain CBS-3)
P59395 5.61e-22 95 32 3 208 3 caiD Carnitinyl-CoA dehydratase Shigella flexneri
B5BL54 5.79e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi A (strain AKU_12601)
C0Q4L2 5.79e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi C (strain RKS4594)
Q5PIL1 5.79e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57TJ1 5.79e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella choleraesuis (strain SC-B67)
B5F749 5.79e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella agona (strain SL483)
P31551 5.97e-22 95 32 3 208 1 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain K12)
B1IRE0 5.97e-22 95 32 3 208 3 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8XA35 6.61e-22 95 32 3 208 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O157:H7
B1LFW9 7.03e-22 95 32 3 208 3 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain SMS-3-5 / SECEC)
B5RGA4 7.11e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1Q9 7.11e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella enteritidis PT4 (strain P125109)
A9MYJ5 7.18e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5FHG4 7.18e-22 95 29 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella dublin (strain CT_02021853)
Q8FLA6 8.04e-22 95 32 3 208 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLV3 8.04e-22 95 32 3 208 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
O87872 1.17e-21 96 32 1 171 1 oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Thauera aromatica
A8ALR7 1.25e-21 94 30 5 256 3 caiD Carnitinyl-CoA dehydratase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O53561 1.63e-21 94 29 5 248 1 echA19 Enoyl-CoA hydratase EchA19 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN3 3.78e-21 93 29 4 206 1 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN2 3.78e-21 93 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U753 3.78e-21 93 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KN36 3.78e-21 93 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TXE1 3.78e-21 93 29 4 206 1 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7U004 7.57e-21 92 29 5 264 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0PJR5 9.39e-21 92 28 4 262 2 echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Danio rerio
P9WNN7 1.35e-20 92 29 5 264 1 echA12 Probable enoyl-CoA hydratase EchA12 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN6 1.35e-20 92 29 5 264 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8GB17 1.37e-20 91 27 5 260 1 caiD Carnitinyl-CoA dehydratase Proteus sp. (strain LE138)
B4EY26 1.37e-20 91 27 5 260 3 caiD Carnitinyl-CoA dehydratase Proteus mirabilis (strain HI4320)
P52045 1.88e-20 91 28 4 251 1 scpB Methylmalonyl-CoA decarboxylase Escherichia coli (strain K12)
A9MR28 1.92e-20 91 29 4 250 3 caiD Carnitinyl-CoA dehydratase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9JS71 2.68e-20 91 28 9 264 2 echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Xenopus laevis
Q9WUR2 2.99e-20 92 30 4 214 1 Eci2 Enoyl-CoA delta isomerase 2 Mus musculus
Q4WF54 3.54e-20 90 30 5 253 1 sidH Mevalonyl-coenzyme A hydratase sidH Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q6NL24 5.3e-20 90 29 8 229 1 ECHIA Probable enoyl-CoA hydratase 1, peroxisomal Arabidopsis thaliana
Q78JN3 6.13e-20 90 30 6 218 1 Eci3 Enoyl-CoA delta isomerase 3, peroxisomal Mus musculus
P94549 9.67e-20 89 30 5 247 2 fadB Probable enoyl-CoA hydratase Bacillus subtilis (strain 168)
Q54HG7 8.76e-19 87 25 4 249 3 auh Methylglutaconyl-CoA hydratase, mitochondrial Dictyostelium discoideum
Q9JLZ3 9.42e-19 87 29 5 259 1 Auh Methylglutaconyl-CoA hydratase, mitochondrial Mus musculus
Q50130 2.74e-18 85 27 6 253 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium leprae (strain TN)
A0R4Q3 3.13e-18 85 27 6 249 3 echA19 Enoyl-CoA hydratase EchA19 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2LXU2 3.49e-18 87 27 2 186 1 bamA 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Syntrophus aciditrophicus (strain SB)
Q8DSN0 3.91e-18 85 27 5 263 3 fabM Trans-2-decenoyl-[acyl-carrier-protein] isomerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9LCU3 4.97e-18 85 30 3 203 1 fcbB2 4-chlorobenzoyl coenzyme A dehalogenase-2 Arthrobacter sp.
F9XMX6 6.83e-18 85 25 5 260 3 MYCGRDRAFT_76805 Enoyl-CoA isomerase/hydratase MYCGRDRAFT_76805 Zymoseptoria tritici (strain CBS 115943 / IPO323)
F1LU71 6.9e-18 85 29 5 259 1 Auh Methylglutaconyl-CoA hydratase, mitochondrial Rattus norvegicus
O85078 1.07e-17 84 29 3 206 1 fcbB1 4-chlorobenzoyl coenzyme A dehalogenase-1 Arthrobacter sp.
A0A481WNM8 1.14e-17 86 27 6 259 3 claC Enoyl-CoA isomerase/hydratase claC Penicillium crustosum
P77467 1.36e-17 83 29 6 265 1 paaG 1,2-epoxyphenylacetyl-CoA isomerase Escherichia coli (strain K12)
Q13825 4.13e-17 83 28 5 259 1 AUH Methylglutaconyl-CoA hydratase, mitochondrial Homo sapiens
O75521 1.02e-16 82 30 5 219 1 ECI2 Enoyl-CoA delta isomerase 2 Homo sapiens
Q5XIC0 1.28e-16 82 28 3 205 1 Eci2 Enoyl-CoA delta isomerase 2 Rattus norvegicus
P53526 4.86e-16 79 31 4 175 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium leprae (strain TN)
Q589W8 7.02e-16 79 28 6 252 3 ACTT3 Enoyl-CoA hydratase ACTT3 Alternaria alternata
Q9P4U9 1.37e-15 78 28 6 257 3 AKT3-1 Enoyl-CoA hydratase AKT3-1 Alternaria alternata
Q9P4U7 1.65e-15 78 28 6 257 3 AKT3-2 Enoyl-CoA hydratase AKT3-2 Alternaria alternata
Q54SS0 1.82e-15 78 29 9 274 3 ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Dictyostelium discoideum
P41942 1.97e-15 77 25 2 209 3 B0272.4 Uncharacterized protein B0272.4 Caenorhabditis elegans
Q5ZJ60 6.14e-15 77 32 2 160 2 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Gallus gallus
Q39659 7.47e-15 77 30 3 193 1 None Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a Cucumis sativus
P45361 1.3e-14 73 34 3 153 3 crt Short-chain-enoyl-CoA hydratase (Fragment) Clostridioides difficile
P24162 1.34e-14 75 31 8 264 3 fadB1 Probable enoyl-CoA hydratase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9FHR8 2.74e-14 74 26 6 272 1 DCI1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal Arabidopsis thaliana
Q9XB60 2.76e-14 74 28 4 219 1 carB Carboxymethylproline synthase Pectobacterium carotovorum subsp. carotovorum
Q96VB3 4.26e-14 74 27 6 257 3 AFT3-1 Enoyl-CoA hydratase AFT3-1 Alternaria alternata
Q8XCP2 1.66e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7
B1IXA5 1.73e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q9Y6F8 2e-13 73 24 8 254 1 CDY1 Testis-specific chromodomain protein Y 1 Homo sapiens
Q3YZM2 2.47e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Shigella sonnei (strain Ss046)
Q83QQ0 2.47e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Shigella flexneri
Q2HJD5 2.52e-13 72 24 5 220 2 ECHDC1 Ethylmalonyl-CoA decarboxylase Bos taurus
B5YXY4 2.56e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
B1LME7 2.63e-13 73 27 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
Q0T2E6 2.73e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Shigella flexneri serotype 5b (strain 8401)
B7NP24 2.76e-13 73 27 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q5HZQ8 2.93e-13 72 27 6 248 2 echdc1 Ethylmalonyl-CoA decarboxylase Xenopus laevis
B7M6M2 3.03e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O8 (strain IAI1)
A8A2L0 3.05e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O9:H4 (strain HS)
A7ZPF8 3.05e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LBJ5 3.08e-13 73 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain 55989 / EAEC)
B6I6Q4 3.58e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain SE11)
B2TWV4 3.61e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q9Y6F7 4.58e-13 72 26 8 236 1 CDY2A Testis-specific chromodomain protein Y 2 Homo sapiens
Q8DR19 4.63e-13 70 27 5 259 1 fabM Trans-2-decenoyl-[acyl-carrier-protein] isomerase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q32DJ4 5.38e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
B7MGV7 6.41e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B7N5V2 6.59e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q1R972 6.71e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain UTI89 / UPEC)
A1ADI8 6.71e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O1:K1 / APEC
B7UFZ8 6.71e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0TFA6 7.03e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MY16 7.3e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O81 (strain ED1a)
Q8FFG4 7.57e-13 72 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5LLW6 7.77e-13 70 24 3 211 1 dmdD Methylthioacryloyl-CoA hydratase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5RFG0 8.49e-13 70 27 6 229 2 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Pongo abelii
Q0S7P8 8.67e-13 70 29 7 214 1 echA20 (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase Rhodococcus jostii (strain RHA1)
Q31YB7 9.37e-13 71 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Shigella boydii serotype 4 (strain Sb227)
Q55GS6 1.02e-12 70 31 3 161 3 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Dictyostelium discoideum
Q5R4W0 1.16e-12 70 24 6 225 2 ECHDC1 Ethylmalonyl-CoA decarboxylase Pongo abelii
Q9NTX5 1.41e-12 70 24 6 225 1 ECHDC1 Ethylmalonyl-CoA decarboxylase Homo sapiens
Q13011 1.49e-12 70 27 6 229 1 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Homo sapiens
P77399 2.04e-12 70 26 5 229 1 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12)
B1X9L4 2.04e-12 70 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZVN2 2.04e-12 70 26 5 229 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
Q9D9V3 2.26e-12 69 24 6 222 1 Echdc1 Ethylmalonyl-CoA decarboxylase Mus musculus
A8ADP2 8.3e-12 68 26 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P95279 8.99e-12 67 26 6 244 2 echA13 Putative enoyl-CoA hydratase EchA13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9WTK2 1.31e-11 68 27 7 238 1 Cdyl Chromodomain Y-like protein Mus musculus
B5BBA1 1.32e-11 68 26 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain AKU_12601)
Q5PCX6 1.32e-11 68 26 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q62651 1.34e-11 67 26 5 205 1 Ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Rattus norvegicus
Q1K7A4 1.38e-11 68 29 4 178 1 ehd3 Small ribosomal subunit protein mS47 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A2VDC2 2.39e-11 67 30 1 142 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Xenopus laevis
Q6AYK9 2.98e-11 67 25 9 275 1 Cdyl Chromodomain Y-like protein Rattus norvegicus
Q4FQC6 3.08e-11 67 27 5 195 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8J9 3.22e-11 67 27 5 199 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q6NYL3 4.02e-11 66 29 4 174 2 ehhadh Peroxisomal bifunctional enzyme Danio rerio
Q58EB4 4.85e-11 66 30 3 156 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Danio rerio
Q6NVY1 4.86e-11 66 28 1 142 1 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Homo sapiens
Q8QZS1 5.17e-11 65 30 1 142 1 Hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Mus musculus
A4WCW6 6.84e-11 66 27 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Enterobacter sp. (strain 638)
O35459 7.72e-11 65 27 8 212 1 Ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Mus musculus
Q8ZNA7 8.45e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RCL3 8.69e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3R9 8.69e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella enteritidis PT4 (strain P125109)
Q8Z4Z0 8.85e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella typhi
Q57LW6 8.85e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella choleraesuis (strain SC-B67)
B5FPN1 8.93e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella dublin (strain CT_02021853)
B4SZR0 9.01e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella newport (strain SL254)
B4TCA8 9.01e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella heidelberg (strain SL476)
B5EZR9 9.01e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella agona (strain SL483)
A9N453 9.1e-11 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q7MZ92 1.04e-10 65 26 5 197 3 fadB Fatty acid oxidation complex subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4TQC2 1.12e-10 65 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella schwarzengrund (strain CVM19633)
P40802 1.62e-10 63 26 6 218 1 pksI Putative polyketide biosynthesis enoyl-CoA isomerase PksI Bacillus subtilis (strain 168)
Q5XIE6 1.76e-10 64 29 2 143 1 Hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Rattus norvegicus
Q6AYG5 1.86e-10 63 24 7 227 1 Echdc1 Ethylmalonyl-CoA decarboxylase Rattus norvegicus
O07533 1.99e-10 63 26 7 249 3 yhaR Putative enoyl-CoA hydratase/isomerase YhaR Bacillus subtilis (strain 168)
Q5QXM1 2.29e-10 64 28 3 182 3 fadJ Fatty acid oxidation complex subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q08426 2.44e-10 64 28 7 206 1 EHHADH Peroxisomal bifunctional enzyme Homo sapiens
Q9Y232 3.1e-10 63 24 6 248 1 CDYL Chromodomain Y-like protein Homo sapiens
Q28C91 3.67e-10 62 26 4 182 2 echdc1 Ethylmalonyl-CoA decarboxylase Xenopus tropicalis
F1NB38 3.93e-10 62 25 6 221 3 ECHDC1 Ethylmalonyl-CoA decarboxylase Gallus gallus
Q869N6 4.14e-10 62 25 7 220 3 DDB_G0271866 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial Dictyostelium discoideum
Q9ZPI6 4.55e-10 63 30 6 206 1 AIM1 Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 Arabidopsis thaliana
Q9D5D8 4.72e-10 63 25 5 218 1 Cdyl2 Chromodomain Y-like protein 2 Mus musculus
I6Y3U6 5.43e-10 62 28 7 208 1 echA20 (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7N288 5.73e-10 63 27 3 183 3 fadJ Fatty acid oxidation complex subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8N8U2 6.18e-10 63 25 5 218 1 CDYL2 Chromodomain Y-like protein 2 Homo sapiens
Q5R5M8 7.06e-10 63 28 7 206 2 EHHADH Peroxisomal bifunctional enzyme Pongo abelii
Q9DBM2 7.31e-10 63 29 5 189 1 Ehhadh Peroxisomal bifunctional enzyme Mus musculus
V5XZU2 8.75e-10 62 26 7 209 3 AKT6-1 Enoyl-CoA hydratase AKT6-1 Alternaria alternata
Q28FR6 8.88e-10 62 30 1 142 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Xenopus tropicalis
O74802 1.08e-09 62 28 4 157 1 snr1 Small ribosomal subunit protein mS47 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A5WH99 1.22e-09 62 28 6 196 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter sp. (strain PRwf-1)
P9WNN5 1.39e-09 60 30 3 183 1 echA14 Probable enoyl-CoA hydratase EchA14 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN4 1.39e-09 60 30 3 183 3 echA14 Probable enoyl-CoA hydratase echA14 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64019 1.39e-09 60 30 3 183 1 echA14 Probable enoyl-CoA hydratase echA14 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
V5XZU7 1.51e-09 61 27 6 192 3 AFT6-1 Enoyl-CoA hydratase AFT6-1 Alternaria alternata
P55100 1.55e-09 62 28 7 231 2 EHHADH Peroxisomal bifunctional enzyme Cavia porcellus
A6WHA0 1.94e-09 61 26 5 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS185)
O49809 2.43e-09 61 29 3 193 2 None Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a Brassica napus
C5NN19 2.65e-09 60 27 5 174 3 ACTT6 Enoyl-CoA hydratase ACTT6 Alternaria alternata
B5XVW2 2.75e-09 61 26 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae (strain 342)
B8E3R3 2.83e-09 61 26 5 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS223)
A7MH81 2.85e-09 61 25 3 182 3 fadJ Fatty acid oxidation complex subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
A3CYJ4 3.18e-09 61 26 5 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1JK30 3.77e-09 60 33 3 139 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8W1L6 3.84e-09 60 28 2 190 1 MFP Peroxisomal fatty acid beta-oxidation multifunctional protein Oryza sativa subsp. japonica
Q6LW06 4.12e-09 60 25 2 192 3 fadB Fatty acid oxidation complex subunit alpha Photobacterium profundum (strain SS9)
A8G8D1 4.17e-09 60 24 2 198 3 fadB Fatty acid oxidation complex subunit alpha Serratia proteamaculans (strain 568)
B7LLD0 4.34e-09 60 25 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8EKR9 4.67e-09 60 26 7 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2HJ73 5.17e-09 60 29 3 148 2 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Bos taurus
A9KU91 5.87e-09 60 25 5 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS195)
Q8DDK6 7.81e-09 59 25 4 220 3 fadB Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain CMCP6)
Q6D2L7 8.06e-09 59 25 4 181 3 fadJ Fatty acid oxidation complex subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1KCZ3 9.6e-09 59 25 4 197 3 fadB Fatty acid oxidation complex subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HPB7 1.15e-08 59 25 7 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-4)
Q0I0T3 1.29e-08 59 24 6 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-7)
Q08A39 1.3e-08 59 24 4 200 3 fadB Fatty acid oxidation complex subunit alpha Shewanella frigidimarina (strain NCIMB 400)
A0KR50 1.41e-08 58 25 7 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain ANA-3)
A3QFP3 1.64e-08 58 28 5 200 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C6DAL7 1.68e-08 58 24 3 192 3 fadJ Fatty acid oxidation complex subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A4XSM8 2.12e-08 58 24 5 245 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas mendocina (strain ymp)
B6EGU2 2.35e-08 58 22 6 222 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio salmonicida (strain LFI1238)
A1RDW6 3.08e-08 58 25 5 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain W3-18-1)
A4Y1B6 3.08e-08 58 25 5 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6TC19 5.56e-08 57 25 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8BMS1 5.77e-08 57 25 4 202 1 Hadha Trifunctional enzyme subunit alpha, mitochondrial Mus musculus
Q1PEY5 5.88e-08 56 28 3 150 2 At2g30650 Probable 3-hydroxyisobutyryl-CoA hydrolase 2 Arabidopsis thaliana
A0KEL1 8.44e-08 56 24 2 194 3 fadB Fatty acid oxidation complex subunit alpha Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4TM82 8.8e-08 56 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis (strain Pestoides F)
A3Q8U4 8.83e-08 56 25 5 222 3 fadB Fatty acid oxidation complex subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q668V1 9.05e-08 56 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CHK2 9.28e-08 56 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZD45 9.28e-08 56 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis
Q1C660 9.28e-08 56 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGK1 9.28e-08 56 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7N1D2 9.44e-08 56 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q07ZP8 1.08e-07 56 27 6 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella frigidimarina (strain NCIMB 400)
A3D684 1.21e-07 56 27 4 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q7MQH9 1.3e-07 56 24 4 220 3 fadB Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain YJ016)
Q1I7D4 1.3e-07 56 23 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas entomophila (strain L48)
Q87TN9 1.47e-07 55 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0TL21 1.79e-07 55 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q4KFC4 1.91e-07 55 24 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1JIG4 2.06e-07 55 25 4 182 3 fadB Fatty acid oxidation complex subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q87ZB2 2.31e-07 55 24 3 191 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q32A21 2.52e-07 55 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
G4V4T6 2.55e-07 55 27 10 287 1 dpgC (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase Amycolatopsis orientalis
A7MQP0 2.61e-07 55 25 6 221 3 fadB Fatty acid oxidation complex subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
P07896 2.68e-07 55 28 6 191 1 Ehhadh Peroxisomal bifunctional enzyme Rattus norvegicus
A1RI92 2.71e-07 55 28 5 198 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain W3-18-1)
A6V382 3.08e-07 55 22 5 245 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain PA7)
Q9ZPI5 3.1e-07 55 27 3 192 1 MFP2 Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 Arabidopsis thaliana
Q4ZRA0 3.18e-07 55 24 3 185 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
P42125 3.37e-07 53 26 3 176 1 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial Mus musculus
A4STF2 3.44e-07 54 23 2 193 3 fadB Fatty acid oxidation complex subunit alpha Aeromonas salmonicida (strain A449)
Q8KLK7 3.49e-07 54 24 5 284 1 BU52_01220 (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase Streptomyces toyocaensis
A1S7L6 3.62e-07 54 26 6 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9HZJ2 3.63e-07 54 22 5 245 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PH8 3.63e-07 54 22 5 245 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYR6 3.63e-07 54 22 5 245 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain LESB58)
A4Y897 4.66e-07 54 28 5 198 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q64428 4.81e-07 54 24 4 202 1 Hadha Trifunctional enzyme subunit alpha, mitochondrial Rattus norvegicus
Q0HWN3 4.88e-07 54 26 5 201 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-7)
Q0HKD1 4.88e-07 54 26 5 201 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-4)
A6WQ25 5.48e-07 54 27 4 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS185)
B1LM32 5.74e-07 54 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
A8A6V1 5.9e-07 54 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O9:H4 (strain HS)
Q8ECP7 6e-07 54 26 5 201 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q83PG1 6.11e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Shigella flexneri
Q0SZ36 6.11e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Shigella flexneri serotype 5b (strain 8401)
B5YY93 6.69e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X8I2 6.69e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7
B1JP63 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TR27 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis (strain Pestoides F)
Q1CN99 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R754 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAN0 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis
Q1C2C4 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDF2 6.75e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66FR8 6.94e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K0Z6 6.94e-07 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q8FBI2 7.39e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1R466 7.52e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain UTI89 / UPEC)
B7MHD1 7.52e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B5XYH0 7.66e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae (strain 342)
C3K613 7.69e-07 53 24 6 249 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain SBW25)
Q0TAL0 7.73e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NFE7 8.31e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NV20 8.54e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UNH4 8.62e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7N2F2 8.69e-07 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O81 (strain ED1a)
Q48GW3 9.57e-07 53 24 3 191 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
F1R6N4 9.77e-07 52 27 4 177 3 echdc1 Ethylmalonyl-CoA decarboxylase Danio rerio
A8FP63 9.81e-07 53 23 5 197 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sediminis (strain HAW-EB3)
A6TGM4 1.17e-06 53 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6DAP5 1.2e-06 53 23 3 212 3 fadB Fatty acid oxidation complex subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P28793 1.5e-06 52 22 5 245 1 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fragi
Q5QXH7 1.56e-06 52 25 1 178 3 fadB Fatty acid oxidation complex subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B2TVJ5 1.71e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IW61 1.71e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M649 1.71e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O8 (strain IAI1)
B7L9A7 1.71e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain 55989 / EAEC)
Q3YVC1 1.73e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Shigella sonnei (strain Ss046)
P21177 1.73e-06 52 25 6 222 1 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12)
B1XAK8 1.73e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / DH10B)
C5A020 1.73e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
A8GH86 1.91e-06 52 24 5 193 3 fadJ Fatty acid oxidation complex subunit alpha Serratia proteamaculans (strain 568)
A4WFX4 2.03e-06 52 23 5 220 3 fadB Fatty acid oxidation complex subunit alpha Enterobacter sp. (strain 638)
A4VKA3 2.07e-06 52 23 6 254 3 fadB Fatty acid oxidation complex subunit alpha Stutzerimonas stutzeri (strain A1501)
Q5E8X6 2.26e-06 52 23 7 224 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q3K9D8 2.31e-06 52 23 5 245 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain Pf0-1)
A0KV76 2.46e-06 52 26 5 201 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain ANA-3)
B7LTY9 2.52e-06 52 25 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q9KT58 2.84e-06 52 25 5 193 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B1J5A5 2.97e-06 52 22 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain W619)
B0VLX4 3e-06 52 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain SDF)
B7VGL4 3.01e-06 52 24 2 176 3 fadB Fatty acid oxidation complex subunit alpha Vibrio atlanticus (strain LGP32)
A5F2P2 3.02e-06 52 25 5 193 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B2I2J9 3.09e-06 52 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain ACICU)
A7ZU51 3.16e-06 52 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
B0VE45 3.29e-06 52 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AYE)
B7I3P1 3.29e-06 52 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AB0057)
B7H1I0 3.29e-06 52 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AB307-0294)
Q6NMB0 3.49e-06 51 24 3 158 2 At2g30660 Probable 3-hydroxyisobutyryl-CoA hydrolase 3 Arabidopsis thaliana
A1S1I8 3.53e-06 51 22 4 198 3 fadB Fatty acid oxidation complex subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9AHY3 4e-06 51 22 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida
Q6FF68 4.12e-06 51 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A5W6H0 4.71e-06 51 23 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q87MM3 4.99e-06 51 24 4 181 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B4TNZ1 5.32e-06 51 26 4 180 3 fadB Fatty acid oxidation complex subunit alpha Salmonella schwarzengrund (strain CVM19633)
B0KH74 5.59e-06 51 22 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain GB-1)
B4SZ85 6.91e-06 50 25 7 222 3 fadB Fatty acid oxidation complex subunit alpha Salmonella newport (strain SL254)
B6I4I6 6.97e-06 50 24 6 222 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain SE11)
Q93Q12 7.06e-06 50 22 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas oleovorans
Q9LKJ1 7.14e-06 50 23 3 193 1 CHY1 3-hydroxyisobutyryl-CoA hydrolase 1 Arabidopsis thaliana
Q7MIS5 7.29e-06 50 23 3 180 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain YJ016)
Q88L02 1.04e-05 50 23 6 247 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8DB47 1.12e-05 50 23 3 180 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain CMCP6)
B5FEW8 1.27e-05 50 21 6 221 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain MJ11)
A7MS61 1.45e-05 49 23 4 181 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q8Z3C6 1.46e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella typhi
Q6LTK3 1.46e-05 49 24 6 185 3 fadJ Fatty acid oxidation complex subunit alpha Photobacterium profundum (strain SS9)
B5RFL6 1.5e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW85 1.5e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella enteritidis PT4 (strain P125109)
A9MYB0 1.55e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57HM6 1.55e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella choleraesuis (strain SC-B67)
B5BIZ0 1.58e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain AKU_12601)
Q5PKQ2 1.58e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O87873 1.58e-05 48 23 10 256 1 dch Cyclohexa-1,5-dienecarbonyl-CoA hydratase Thauera aromatica
Q9L6L5 1.58e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5EZW0 1.65e-05 49 24 4 197 3 fadB Fatty acid oxidation complex subunit alpha Salmonella agona (strain SL483)
P23965 1.84e-05 48 25 4 187 1 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial Rattus norvegicus
Q9F0Y7 1.85e-05 49 24 6 222 3 fadB Fatty acid oxidation complex subunit alpha Enterobacter cloacae
B8CH91 1.88e-05 49 21 4 197 3 fadB Fatty acid oxidation complex subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
A8ACZ4 1.89e-05 49 24 6 225 3 fadB Fatty acid oxidation complex subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P28817 2.33e-05 48 24 4 172 1 EHD3 Small ribosomal subunit protein mS47 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A8GYG0 3.78e-05 48 23 5 218 3 fadB Fatty acid oxidation complex subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q489W3 6.2e-05 47 22 2 190 3 fadB Fatty acid oxidation complex subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B0TLB9 8.47e-05 47 24 6 218 3 fadB Fatty acid oxidation complex subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q5E3U1 8.83e-05 47 23 5 189 3 fadJ Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
A5F465 0.000103 47 21 2 203 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P40939 0.000104 47 23 3 178 1 HADHA Trifunctional enzyme subunit alpha, mitochondrial Homo sapiens
C3LSI3 0.000107 47 21 2 203 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KNI1 0.000107 47 21 2 203 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q29554 0.000112 47 24 3 178 2 HADHA Trifunctional enzyme subunit alpha, mitochondrial Sus scrofa

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02860
Feature type CDS
Gene menB
Product 1,4-dihydroxy-2-naphthoyl-CoA synthase
Location 606065 - 606922 (strand: 1)
Length 858 (nucleotides) / 285 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_374
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00378 Enoyl-CoA hydratase/isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0447 Coenzyme transport and metabolism (H) H 1,4-Dihydroxy-2-naphthoyl-CoA synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MMYPSEEQLCAPVEWVDCTGDYKDILFHKSKDGIAKITINRPEVRNAFRPLTVKEMISALANARYDDGIGTIIFTGQGEKAFCAGGDQKIRGDYGGYQDDTGVHHLNVLDLQRDIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAVFGQTGPKVGSFDGGWGAAYMARIVGQKKAREIWFLCRQYSAQEALDMGLVNTVVPYADLEKETVRWCREMLENSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTDEGQEGRNAFNEKRAPDFSKFKRNP

Flanking regions ( +/- flanking 50bp)

GCAATCCGGACATTTTTATCATTACATTCTGTTTAAAGGAACTCACCGTTATGATGTACCCGAGCGAAGAGCAGCTCTGTGCCCCGGTTGAATGGGTTGATTGCACCGGCGATTATAAAGATATTCTTTTTCATAAATCGAAAGATGGTATCGCCAAAATTACCATTAACCGTCCTGAAGTCCGCAACGCCTTTCGTCCGTTAACGGTCAAAGAGATGATCAGTGCGCTGGCGAATGCCCGCTATGACGATGGTATCGGCACTATTATCTTTACCGGACAGGGTGAAAAAGCGTTCTGTGCGGGCGGTGACCAAAAAATCCGCGGCGATTACGGCGGCTATCAGGATGATACCGGTGTTCATCATCTGAACGTGCTGGACTTACAGCGCGATATCCGTACCTGTCCTAAACCGGTTGTTGCTATGGTGGCGGGTTATTCTATCGGCGGCGGACATGTGCTGCATATGATGTGTGACCTGACTATTGCTGCGGATAATGCGGTGTTTGGTCAGACCGGACCAAAAGTCGGATCATTTGACGGCGGCTGGGGTGCGGCGTATATGGCGCGGATTGTCGGGCAGAAAAAAGCCCGCGAGATCTGGTTCCTCTGCCGTCAGTACAGTGCGCAGGAAGCCCTGGATATGGGACTGGTCAACACAGTTGTTCCTTACGCAGATCTGGAAAAAGAAACTGTGCGCTGGTGTCGTGAAATGCTGGAAAACAGCCCGATGGCACTGCGTTGCCTGAAAGCGGCACTGAATGCGGACTGTGACGGACAGGCCGGATTACAAGAGCTGGCGGGTAATGCCACCATGCTGTTCTATATGACCGACGAAGGTCAGGAAGGACGTAACGCATTTAACGAAAAACGTGCGCCGGACTTCTCTAAATTTAAACGTAATCCGTAATGCGCAGCGCGACCTTATACCGGTTCAGCCTGCCGATGGAGGCAGGCGTT