Homologs in group_2338

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18350 FBDBKF_18350 93.8 Morganella morganii S1 smpB SsrA-binding protein SmpB
EHELCC_18385 EHELCC_18385 93.8 Morganella morganii S2 smpB SsrA-binding protein SmpB
NLDBIP_18310 NLDBIP_18310 93.8 Morganella morganii S4 smpB SsrA-binding protein SmpB
LHKJJB_18505 LHKJJB_18505 93.8 Morganella morganii S3 smpB SsrA-binding protein SmpB
HKOGLL_18240 HKOGLL_18240 93.8 Morganella morganii S5 smpB SsrA-binding protein SmpB
PMI_RS09405 PMI_RS09405 81.9 Proteus mirabilis HI4320 smpB SsrA-binding protein SmpB

Distribution of the homologs in the orthogroup group_2338

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2338

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A9MGS5 5.67e-105 300 85 0 160 3 smpB SsrA-binding protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MHX6 1.26e-104 298 85 0 160 3 smpB SsrA-binding protein Cronobacter sakazakii (strain ATCC BAA-894)
A8ANF2 1.31e-104 298 85 0 160 3 smpB SsrA-binding protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TCM7 3.95e-104 297 85 0 160 3 smpB SsrA-binding protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVJ3 3.95e-104 297 85 0 160 3 smpB SsrA-binding protein Klebsiella pneumoniae (strain 342)
P0A2G1 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2G2 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella typhi
B4TS67 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella schwarzengrund (strain CVM19633)
B5BEA6 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi A (strain AKU_12601)
C0PW29 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi C (strain RKS4594)
A9MZ63 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFG2 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2C5 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella newport (strain SL254)
B4TE63 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella heidelberg (strain SL476)
B5RD96 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUH5 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella enteritidis PT4 (strain P125109)
Q57L18 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella choleraesuis (strain SC-B67)
B5F2A0 4.98e-104 297 84 0 160 3 smpB SsrA-binding protein Salmonella agona (strain SL483)
A4WDI4 6.21e-103 294 84 0 160 3 smpB SsrA-binding protein Enterobacter sp. (strain 638)
Q3YYQ2 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Shigella sonnei (strain Ss046)
P0A835 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Shigella flexneri
Q0T186 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Shigella flexneri serotype 5b (strain 8401)
Q32CW9 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31XC6 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Shigella boydii serotype 4 (strain Sb227)
B2TYP2 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUV4 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8A4 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain UTI89 / UPEC)
B1LPC7 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain SMS-3-5 / SECEC)
B6I641 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain SE11)
B7N6K5 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A832 1.23e-102 293 84 0 160 1 smpB SsrA-binding protein Escherichia coli (strain K12)
B1IVL4 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A833 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AEE9 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O1:K1 / APEC
A8A3C6 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O9:H4 (strain HS)
B1XBU0 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain K12 / DH10B)
C4ZYN7 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7M989 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O8 (strain IAI1)
B7MYQ8 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O81 (strain ED1a)
B7NSB8 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z237 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A834 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O157:H7
B7LDK8 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli (strain 55989 / EAEC)
B7MIV7 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH68 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQ60 1.23e-102 293 84 0 160 3 smpB SsrA-binding protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TEM0 2.85e-102 293 83 0 160 3 smpB SsrA-binding protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B2VEC0 2.3e-100 288 81 0 160 3 smpB SsrA-binding protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NRZ6 4.29e-100 287 82 0 160 3 smpB SsrA-binding protein Sodalis glossinidius (strain morsitans)
B4F065 1.01e-99 286 81 0 160 3 smpB SsrA-binding protein Proteus mirabilis (strain HI4320)
Q7N1U1 1.58e-99 286 81 0 160 3 smpB SsrA-binding protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66DB4 1.95e-98 283 81 0 160 3 smpB SsrA-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNV2 1.95e-98 283 81 0 160 3 smpB SsrA-binding protein Yersinia pestis (strain Pestoides F)
Q1CFK6 1.95e-98 283 81 0 160 3 smpB SsrA-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH14 1.95e-98 283 81 0 160 3 smpB SsrA-binding protein Yersinia pestis
Q1CAH5 1.95e-98 283 81 0 160 3 smpB SsrA-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKS8 1.95e-98 283 81 0 160 3 smpB SsrA-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JKI0 6.25e-98 282 82 0 160 3 smpB SsrA-binding protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6D970 2.63e-97 280 81 0 160 3 smpB SsrA-binding protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BAL3 1.23e-96 278 80 0 160 3 smpB SsrA-binding protein Edwardsiella ictaluri (strain 93-146)
A8GI46 2.02e-96 278 81 0 160 3 smpB SsrA-binding protein Serratia proteamaculans (strain 568)
Q6D8Y5 3.58e-96 277 81 0 160 3 smpB SsrA-binding protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q65SE8 2.47e-94 273 78 1 160 3 smpB SsrA-binding protein Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B3H1K6 4.18e-90 262 78 0 156 3 smpB SsrA-binding protein Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0M7 4.18e-90 262 78 0 156 3 smpB SsrA-binding protein Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VMQ1 2.58e-89 260 77 0 157 3 smpB SsrA-binding protein Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F4Q7 2.78e-89 260 78 1 160 3 smpB SsrA-binding protein Glaesserella parasuis serovar 5 (strain SH0165)
P44967 2.89e-89 260 76 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UD90 2.89e-89 260 76 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain PittEE)
Q4QLS9 2.89e-89 260 76 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain 86-028NP)
A5UIC0 3.52e-89 259 76 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain PittGG)
Q7VM64 3.36e-88 257 78 0 156 3 smpB SsrA-binding protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0USL1 3.63e-87 254 76 1 160 3 smpB SsrA-binding protein Histophilus somni (strain 2336)
Q0I279 3.63e-87 254 76 1 160 3 smpB SsrA-binding protein Histophilus somni (strain 129Pt)
P57827 1.63e-86 253 74 1 158 3 smpB SsrA-binding protein Pasteurella multocida (strain Pm70)
C4K4E2 7.65e-86 251 70 0 160 3 smpB SsrA-binding protein Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C4L8Z2 7.3e-80 236 68 0 160 3 smpB SsrA-binding protein Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A0KI80 1.91e-77 230 67 1 161 3 smpB SsrA-binding protein Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1SV84 2.98e-75 224 66 1 161 3 smpB SsrA-binding protein Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C3LT98 6.41e-74 221 63 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain M66-2)
P52116 6.41e-74 221 63 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F375 6.41e-74 221 63 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87RY2 1.34e-73 220 62 1 161 3 smpB SsrA-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A4SPV7 1.59e-73 220 64 1 161 3 smpB SsrA-binding protein Aeromonas salmonicida (strain A449)
A7MWX4 3.77e-72 216 60 1 161 3 smpB SsrA-binding protein Vibrio campbellii (strain ATCC BAA-1116)
A3QCE0 2.2e-71 215 66 1 150 3 smpB SsrA-binding protein Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B6EKA9 3.12e-70 212 59 1 161 3 smpB SsrA-binding protein Aliivibrio salmonicida (strain LFI1238)
B5FA19 1.12e-68 208 57 1 161 3 smpB SsrA-binding protein Aliivibrio fischeri (strain MJ11)
Q5QW47 1.29e-68 207 58 1 160 3 smpB SsrA-binding protein Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q5E399 1.85e-68 207 57 1 161 3 smpB SsrA-binding protein Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8H222 4.59e-68 206 61 2 161 3 smpB SsrA-binding protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLG2 4.59e-68 206 61 2 161 3 smpB SsrA-binding protein Shewanella halifaxensis (strain HAW-EB4)
Q6LUB4 2.86e-67 204 59 1 157 3 smpB SsrA-binding protein Photobacterium profundum (strain SS9)
Q15V28 3.89e-67 204 60 0 155 3 smpB SsrA-binding protein Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A8FT45 2.88e-66 202 63 1 146 3 smpB SsrA-binding protein Shewanella sediminis (strain HAW-EB3)
Q7MN99 4.98e-66 201 64 1 159 3 smpB SsrA-binding protein Vibrio vulnificus (strain YJ016)
Q8DF53 4.98e-66 201 64 1 159 3 smpB SsrA-binding protein Vibrio vulnificus (strain CMCP6)
B1KKG8 1.05e-65 200 62 1 146 3 smpB SsrA-binding protein Shewanella woodyi (strain ATCC 51908 / MS32)
Q3IE36 1.96e-65 199 56 0 157 3 smpB SsrA-binding protein Pseudoalteromonas translucida (strain TAC 125)
Q0HSR7 2.92e-64 197 58 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain MR-7)
Q8EGW8 2.92e-64 197 58 1 157 3 smpB SsrA-binding protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q604C6 3.23e-64 196 58 1 156 3 smpB SsrA-binding protein Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0HGH0 5.51e-64 196 57 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain MR-4)
A0KZF9 5.51e-64 196 57 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain ANA-3)
Q47XH8 1.54e-63 195 59 0 145 3 smpB SsrA-binding protein Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1S886 1.61e-63 195 60 2 155 3 smpB SsrA-binding protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B4RXY7 1.92e-63 194 55 0 158 3 smpB SsrA-binding protein Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q12PV1 3.1e-63 194 58 2 159 3 smpB SsrA-binding protein Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A4VPR2 1.07e-62 192 60 1 160 3 smpB SsrA-binding protein Stutzerimonas stutzeri (strain A1501)
Q5WSX5 1.18e-62 192 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Lens)
Q5X148 1.18e-62 192 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Paris)
Q5ZRP1 1.33e-62 192 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5II10 1.33e-62 192 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Corby)
A1U622 1.64e-62 192 58 0 159 3 smpB SsrA-binding protein Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1IF66 1.89e-62 192 58 1 160 3 smpB SsrA-binding protein Pseudomonas entomophila (strain L48)
Q085W8 5.96e-62 191 56 2 157 3 smpB SsrA-binding protein Shewanella frigidimarina (strain NCIMB 400)
Q88DT6 2.12e-61 189 58 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9A9 2.12e-61 189 58 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q6F8J9 7.16e-61 188 59 0 148 3 smpB SsrA-binding protein Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0KIT1 7.89e-61 188 58 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain GB-1)
A4XYG4 1.66e-60 187 58 1 160 3 smpB SsrA-binding protein Pseudomonas mendocina (strain ymp)
Q8KTI4 2.74e-60 186 58 1 160 3 smpB SsrA-binding protein Azotobacter vinelandii
C1DFN0 2.74e-60 186 58 1 160 3 smpB SsrA-binding protein Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B1J247 4.07e-60 186 56 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain W619)
Q0VSU5 8.03e-60 185 57 1 154 3 smpB SsrA-binding protein Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q4KIH9 1.95e-59 184 56 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9HV40 5.62e-59 183 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FQ4 5.62e-59 183 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1I0 5.62e-59 183 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain LESB58)
A6VCM5 5.62e-59 183 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain PA7)
A1WX40 7.77e-59 183 54 0 153 3 smpB SsrA-binding protein Halorhodospira halophila (strain DSM 244 / SL1)
A5WH04 9.52e-59 182 57 1 154 3 smpB SsrA-binding protein Psychrobacter sp. (strain PRwf-1)
Q4FUW4 1.83e-58 182 55 1 153 3 smpB SsrA-binding protein Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
C5BQH7 4.55e-58 181 56 1 160 3 smpB SsrA-binding protein Teredinibacter turnerae (strain ATCC 39867 / T7901)
A6W2E0 6.04e-58 181 54 0 157 3 smpB SsrA-binding protein Marinomonas sp. (strain MWYL1)
A9KGA3 7.51e-58 180 52 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain Dugway 5J108-111)
B6IZH7 7.51e-58 180 52 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain CbuG_Q212)
B0U3K6 9.91e-58 180 57 0 144 3 smpB SsrA-binding protein Xylella fastidiosa (strain M12)
B0V8G6 1.19e-57 180 56 0 148 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AYE)
A3M2Y4 1.19e-57 180 56 0 148 3 smpB SsrA-binding protein Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HUN4 1.19e-57 180 56 0 148 3 smpB SsrA-binding protein Acinetobacter baumannii (strain ACICU)
B7I7Q2 1.19e-57 180 56 0 148 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AB0057)
B7GYP8 1.19e-57 180 56 0 148 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AB307-0294)
Q0A7D4 1.33e-57 180 54 0 153 3 smpB SsrA-binding protein Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1RLZ8 1.47e-57 180 59 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain W3-18-1)
A4Y4S4 1.47e-57 180 59 1 157 3 smpB SsrA-binding protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B4SS56 1.55e-57 180 54 0 148 3 smpB SsrA-binding protein Stenotrophomonas maltophilia (strain R551-3)
Q1QDW1 1.91e-57 179 54 1 153 3 smpB SsrA-binding protein Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q2SMN6 2.08e-57 179 57 1 156 3 smpB SsrA-binding protein Hahella chejuensis (strain KCTC 2396)
Q83C29 2.34e-57 179 52 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B2FMX5 2.77e-57 179 54 0 148 3 smpB SsrA-binding protein Stenotrophomonas maltophilia (strain K279a)
B6J7W1 3.87e-57 179 52 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain CbuK_Q154)
Q9PAZ7 6.22e-57 178 56 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain 9a5c)
A9KTG8 7.36e-57 178 58 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS195)
A6WKV9 7.36e-57 178 58 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS185)
A3D262 7.36e-57 178 58 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EAZ5 7.36e-57 178 58 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS223)
Q87BS0 8.17e-57 178 56 0 144 3 smpB SsrA-binding protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6G4 8.17e-57 178 56 0 144 3 smpB SsrA-binding protein Xylella fastidiosa (strain M23)
A9N8I5 8.51e-57 177 52 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain RSA 331 / Henzerling II)
Q4ZNN9 9.91e-57 177 56 1 160 3 smpB SsrA-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q87WN1 1.85e-56 177 55 1 160 3 smpB SsrA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q31FR9 7.35e-56 175 56 1 155 3 smpB SsrA-binding protein Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q48E54 9.74e-56 175 55 0 156 3 smpB SsrA-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3KIA8 9.96e-56 175 55 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain Pf0-1)
C3K282 3.04e-55 174 55 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain SBW25)
Q8PMB9 5.74e-55 173 52 1 161 3 smpB SsrA-binding protein Xanthomonas axonopodis pv. citri (strain 306)
Q1QSW3 6.27e-55 173 52 1 156 3 smpB SsrA-binding protein Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5CX31 6.52e-55 173 53 0 154 3 smpB SsrA-binding protein Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q3BVC6 9.08e-55 173 52 1 161 3 smpB SsrA-binding protein Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A1AW41 9.82e-55 172 53 0 147 3 smpB SsrA-binding protein Ruthia magnifica subsp. Calyptogena magnifica
Q8PAL7 1.42e-54 172 52 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVV0 1.42e-54 172 52 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain B100)
Q4UT03 1.42e-54 172 52 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain 8004)
Q21H28 2.35e-54 171 52 0 151 3 smpB SsrA-binding protein Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5H194 9.1e-54 170 51 1 160 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQV2 9.1e-54 170 51 1 160 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P468 9.94e-54 170 51 1 160 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2Y9R5 1.13e-52 167 52 0 144 3 smpB SsrA-binding protein Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B0TY34 1.73e-52 167 53 0 154 3 smpB SsrA-binding protein Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B3PF48 3.43e-52 166 52 0 157 3 smpB SsrA-binding protein Cellvibrio japonicus (strain Ueda107)
A4IYL4 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFP4 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BMI2 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain OSU18)
B2SGA3 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A446 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain LVS)
A7NBC7 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14H46 5.81e-52 165 53 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain FSC 198)
Q3JBU6 6.83e-52 166 52 0 144 3 smpB SsrA-binding protein Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5EXZ5 7.36e-52 165 51 0 143 3 smpB SsrA-binding protein Dichelobacter nodosus (strain VCS1703A)
Q1LSR7 1.86e-51 164 58 0 149 3 smpB SsrA-binding protein Baumannia cicadellinicola subsp. Homalodisca coagulata
A0Q735 3.02e-51 164 51 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. novicida (strain U112)
Q8XZH1 6.3e-51 162 52 0 144 3 smpB SsrA-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q47DK3 6.57e-51 162 50 0 148 3 smpB SsrA-binding protein Dechloromonas aromatica (strain RCB)
Q3SI24 7.58e-51 162 50 0 146 3 smpB SsrA-binding protein Thiobacillus denitrificans (strain ATCC 25259)
Q82X65 2.46e-50 161 48 0 144 3 smpB SsrA-binding protein Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1K5T8 3.07e-50 160 50 0 144 3 smpB SsrA-binding protein Azoarcus sp. (strain BH72)
B2UBC4 6.46e-50 160 51 0 144 3 smpB SsrA-binding protein Ralstonia pickettii (strain 12J)
Q21VE0 7.1e-50 160 51 1 152 3 smpB SsrA-binding protein Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B3R297 7.6e-50 160 52 0 144 3 smpB SsrA-binding protein Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0AIG7 1.26e-49 159 48 0 144 3 smpB SsrA-binding protein Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0KA36 1.32e-49 159 52 0 144 3 smpB SsrA-binding protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7NSG2 1.61e-49 159 51 0 145 3 smpB SsrA-binding protein Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1W8Y5 2.97e-49 158 51 1 152 3 smpB SsrA-binding protein Acidovorax sp. (strain JS42)
B9MGQ0 2.97e-49 158 51 1 152 3 smpB SsrA-binding protein Acidovorax ebreus (strain TPSY)
Q7VYA8 3.18e-49 158 48 0 148 3 smpB SsrA-binding protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WJ73 3.18e-49 158 48 0 148 3 smpB SsrA-binding protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L136 3.3e-49 158 50 0 148 3 smpB SsrA-binding protein Bordetella avium (strain 197N)
Q5NYE0 3.79e-49 158 50 0 144 3 smpB SsrA-binding protein Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7WA41 3.87e-49 158 48 0 148 3 smpB SsrA-binding protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q1LND7 3.95e-49 158 51 0 144 3 smpB SsrA-binding protein Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1WPQ3 5.24e-49 158 50 2 161 3 smpB SsrA-binding protein Verminephrobacter eiseniae (strain EF01-2)
A4SYS6 9.99e-49 157 50 0 144 3 smpB SsrA-binding protein Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q470F7 4.27e-48 155 50 0 144 3 smpB SsrA-binding protein Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1TSJ4 8.96e-48 155 51 1 152 3 smpB SsrA-binding protein Paracidovorax citrulli (strain AAC00-1)
B8D7F1 1.27e-47 154 46 0 143 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57342 1.27e-47 154 46 0 143 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D947 1.27e-47 154 46 0 143 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B1Y225 1.91e-47 154 48 0 145 3 smpB SsrA-binding protein Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1H274 2.6e-47 153 48 0 144 3 smpB SsrA-binding protein Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q13XD6 2.96e-47 153 46 0 147 3 smpB SsrA-binding protein Paraburkholderia xenovorans (strain LB400)
Q12AT7 1.06e-46 152 51 0 147 3 smpB SsrA-binding protein Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2SWX6 2.52e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63T34 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain K96243)
A3NAS3 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 668)
Q3JR53 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 1710b)
A3NWK5 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 1106a)
A1V545 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain SAVP1)
Q62JE7 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain ATCC 23344)
A2SB97 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain NCTC 10229)
A3MKR8 6.16e-46 150 47 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain NCTC 10247)
A4JF55 2.39e-45 148 47 0 144 3 smpB SsrA-binding protein Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BHG2 2.39e-45 148 47 0 144 3 smpB SsrA-binding protein Burkholderia orbicola (strain AU 1054)
A0K8C3 2.39e-45 148 47 0 144 3 smpB SsrA-binding protein Burkholderia cenocepacia (strain HI2424)
Q0BE35 3.61e-45 148 47 0 144 3 smpB SsrA-binding protein Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39F63 4.16e-45 147 47 0 144 3 smpB SsrA-binding protein Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A1KUW3 4.64e-45 147 46 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0Y8 4.64e-45 147 46 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Y7 4.64e-45 147 46 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M0W1 4.64e-45 147 46 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup C (strain 053442)
A2SG89 2.65e-44 146 47 0 144 3 smpB SsrA-binding protein Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q5F816 3.69e-44 145 46 0 145 3 smpB SsrA-binding protein Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q39V47 1.52e-43 144 49 2 151 3 smpB SsrA-binding protein Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5UPS2 2.18e-43 144 47 0 148 3 smpB SsrA-binding protein Roseiflexus sp. (strain RS-1)
B0JTG1 3.89e-43 143 48 0 143 3 smpB SsrA-binding protein Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A1ANL4 4.31e-43 142 45 1 151 3 smpB SsrA-binding protein Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q2N9K0 5.03e-43 143 49 2 148 3 smpB SsrA-binding protein Erythrobacter litoralis (strain HTCC2594)
Q74CG4 7.58e-43 142 47 2 151 3 smpB SsrA-binding protein Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9K721 1.41e-42 141 46 1 148 3 smpB SsrA-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5WDM4 1.6e-42 141 45 1 148 3 smpB SsrA-binding protein Shouchella clausii (strain KSM-K16)
Q89AM9 2.59e-42 141 42 1 156 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A5G3A5 5.79e-42 140 46 2 149 3 smpB SsrA-binding protein Geotalea uraniireducens (strain Rf4)
A4ISN8 5.85e-42 140 49 1 134 3 smpB SsrA-binding protein Geobacillus thermodenitrificans (strain NG80-2)
Q2RT81 7.26e-42 140 47 1 147 3 smpB SsrA-binding protein Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9DJK4 8.36e-42 139 46 2 156 3 smpB SsrA-binding protein Staphylococcus carnosus (strain TM300)
Q8K9R5 8.39e-42 140 45 1 148 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5KVF8 1.38e-41 139 46 1 144 3 smpB SsrA-binding protein Geobacillus kaustophilus (strain HTA426)
B8H482 1.4e-41 139 48 2 147 1 smpB SsrA-binding protein Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8Z9 1.4e-41 139 48 2 147 3 smpB SsrA-binding protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q313K7 1.54e-41 139 48 3 158 3 smpB SsrA-binding protein Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B2J722 1.88e-41 139 48 0 147 3 smpB SsrA-binding protein Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A0PYP8 1.91e-41 139 50 1 148 3 smpB SsrA-binding protein Clostridium novyi (strain NT)
C5D7L7 3.31e-41 138 46 1 143 3 smpB SsrA-binding protein Geobacillus sp. (strain WCH70)
B1HWE9 4.4e-41 137 45 1 149 3 smpB SsrA-binding protein Lysinibacillus sphaericus (strain C3-41)
B0T1M3 9.51e-41 137 49 2 147 3 smpB SsrA-binding protein Caulobacter sp. (strain K31)
B7GLX3 1.51e-40 136 46 1 143 3 smpB SsrA-binding protein Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A5N2N2 1.55e-40 136 46 1 154 3 smpB SsrA-binding protein Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E6A8 1.55e-40 136 46 1 154 3 smpB SsrA-binding protein Clostridium kluyveri (strain NBRC 12016)
A7NS28 1.9e-40 136 45 0 148 3 smpB SsrA-binding protein Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B9EAH5 1.92e-40 136 45 1 144 3 smpB SsrA-binding protein Macrococcus caseolyticus (strain JCSC5402)
B2TPV9 3.75e-40 135 45 1 153 3 smpB SsrA-binding protein Clostridium botulinum (strain Eklund 17B / Type B)
B2UY12 3.75e-40 135 45 1 153 3 smpB SsrA-binding protein Clostridium botulinum (strain Alaska E43 / Type E3)
Q8YM70 4.24e-40 135 46 0 145 3 smpB SsrA-binding protein Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B1KTK2 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Loch Maree / Type A3)
A7G9Y7 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IDC3 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Okra / Type B1)
C1FQX0 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Kyoto / Type A2)
A5HYC7 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KZ53 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain 657 / Type Ba4)
A7FQP4 5.37e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain ATCC 19397 / Type A)
Q3MAP3 7.64e-40 134 46 0 145 3 smpB SsrA-binding protein Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B7KF17 9.92e-40 134 45 0 143 3 smpB SsrA-binding protein Gloeothece citriformis (strain PCC 7424)
A8FHG7 1.42e-39 134 44 1 144 3 smpB SsrA-binding protein Bacillus pumilus (strain SAFR-032)
Q8CPX9 1.61e-39 134 45 2 156 3 smpB SsrA-binding protein Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQU5 1.61e-39 134 45 2 156 3 smpB SsrA-binding protein Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8M3R4 2.27e-39 133 47 1 144 3 smpB SsrA-binding protein Salinispora arenicola (strain CNS-205)
A3DJ18 2.4e-39 133 46 1 134 3 smpB SsrA-binding protein Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8NXL2 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MW2)
A8Z1A9 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain USA300 / TCH1516)
Q6GB49 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MSSA476)
Q6GIK9 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MRSA252)
A6QF90 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Newman)
Q5HHN6 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain COL)
Q2YWK9 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G023 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIL2 2.54e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain USA300)
A4X3K9 2.94e-39 133 46 1 151 3 smpB SsrA-binding protein Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
P66863 3.6e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain N315)
P66862 3.6e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQY5 3.6e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain JH9)
A6TZR0 3.6e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain JH1)
A7WZT9 3.6e-39 133 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4FLS2 5.83e-39 132 44 2 150 3 smpB SsrA-binding protein Pelagibacter ubique (strain HTCC1062)
Q88YG7 6.51e-39 132 43 2 157 3 smpB SsrA-binding protein Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A6LR41 1.64e-38 131 45 1 155 3 smpB SsrA-binding protein Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B0BZP2 1.8e-38 131 46 0 144 3 smpB SsrA-binding protein Acaryochloris marina (strain MBIC 11017)
Q7NKI3 1.83e-38 131 47 1 140 3 smpB SsrA-binding protein Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A0ALD2 1.92e-38 131 44 1 143 3 smpB SsrA-binding protein Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66860 1.92e-38 131 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDA8 1.92e-38 131 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4a (strain HCC23)
Q71WX8 1.92e-38 131 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4b (strain F2365)
C1KY87 1.92e-38 131 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4b (strain CLIP80459)
P66861 1.92e-38 131 44 1 143 3 smpB SsrA-binding protein Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B7IP12 2.05e-38 131 44 1 144 3 smpB SsrA-binding protein Bacillus cereus (strain G9842)
Q4L4L2 2.33e-38 131 44 2 156 3 smpB SsrA-binding protein Staphylococcus haemolyticus (strain JCSC1435)
B2G624 2.39e-38 131 42 1 157 3 smpB SsrA-binding protein Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIJ0 2.39e-38 131 42 1 157 3 smpB SsrA-binding protein Limosilactobacillus reuteri (strain DSM 20016)
P59630 2.7e-38 130 43 2 149 3 smpB SsrA-binding protein Enterococcus faecalis (strain ATCC 700802 / V583)
A7GUR1 4.58e-38 130 42 1 149 3 smpB SsrA-binding protein Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B0KA44 4.72e-38 130 48 1 135 3 smpB SsrA-binding protein Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K718 5.55e-38 130 48 1 135 3 smpB SsrA-binding protein Thermoanaerobacter sp. (strain X514)
B9J4L7 5.63e-38 130 43 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain Q1)
B7HW45 5.63e-38 130 43 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain AH187)
Q72XZ2 5.63e-38 130 43 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain ATCC 10987 / NRS 248)
Q67SL8 5.89e-38 130 45 3 147 3 smpB SsrA-binding protein Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9LD60 7.68e-38 129 43 1 158 3 smpB SsrA-binding protein Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WJ45 7.68e-38 129 43 1 158 3 smpB SsrA-binding protein Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q0STE4 1.06e-37 129 43 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain SM101 / Type A)
Q8XKU7 1.06e-37 129 43 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain 13 / Type A)
Q0TQZ6 1.06e-37 129 43 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q815L5 1.19e-37 129 44 1 144 3 smpB SsrA-binding protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HEC5 1.19e-37 129 44 1 144 3 smpB SsrA-binding protein Bacillus cereus (strain B4264)
Q49W09 1.31e-37 129 44 3 156 3 smpB SsrA-binding protein Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q898Q7 1.43e-37 129 45 2 160 3 smpB SsrA-binding protein Clostridium tetani (strain Massachusetts / E88)
P74355 2.13e-37 128 45 0 144 3 smpB SsrA-binding protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1GSC9 2.45e-37 128 46 2 148 3 smpB SsrA-binding protein Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q112L2 2.47e-37 128 43 0 148 3 smpB SsrA-binding protein Trichodesmium erythraeum (strain IMS101)
Q2LU46 2.67e-37 128 48 3 144 3 smpB SsrA-binding protein Syntrophus aciditrophicus (strain SB)
A9VQ41 3.74e-37 127 43 1 144 3 smpB SsrA-binding protein Bacillus mycoides (strain KBAB4)
B8I8G4 3.88e-37 127 43 1 153 3 smpB SsrA-binding protein Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A6Q524 4.84e-37 127 48 2 139 3 smpB SsrA-binding protein Nitratiruptor sp. (strain SB155-2)
Q30TF9 5.05e-37 127 43 1 145 3 smpB SsrA-binding protein Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q1AVL3 5.28e-37 127 45 1 144 3 smpB SsrA-binding protein Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B8G4V8 6.52e-37 127 44 0 145 3 smpB SsrA-binding protein Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q2W477 6.93e-37 127 43 3 152 3 smpB SsrA-binding protein Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A8MFY7 7.19e-37 127 45 2 144 3 smpB SsrA-binding protein Alkaliphilus oremlandii (strain OhILAs)
B8CYF2 8.19e-37 127 44 1 130 3 smpB SsrA-binding protein Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q5MZN2 8.49e-37 127 42 0 149 3 smpB SsrA-binding protein Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31M94 8.49e-37 127 42 0 149 3 smpB SsrA-binding protein Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A7Z8U4 9.82e-37 127 40 1 149 3 smpB SsrA-binding protein Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8DHM0 1.2e-36 126 45 0 145 3 smpB SsrA-binding protein Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q0APB3 1.21e-36 126 45 3 160 3 smpB SsrA-binding protein Maricaulis maris (strain MCS10)
Q6HBG1 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q631M9 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain ZK / E33L)
C1EZ92 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain 03BB102)
B7JFF5 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain AH820)
Q81XA8 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus anthracis
A0RKR7 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus thuringiensis (strain Al Hakam)
C3LDE9 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P072 1.31e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus anthracis (strain A0248)
O32230 1.33e-36 126 40 1 149 1 smpB SsrA-binding protein Bacillus subtilis (strain 168)
Q5NPL5 1.42e-36 126 44 2 150 3 smpB SsrA-binding protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q47M13 1.69e-36 126 44 2 156 3 smpB SsrA-binding protein Thermobifida fusca (strain YX)
A0RNV4 1.84e-36 126 46 1 141 3 smpB SsrA-binding protein Campylobacter fetus subsp. fetus (strain 82-40)
Q1DAN7 2.85e-36 125 43 2 157 3 smpB SsrA-binding protein Myxococcus xanthus (strain DK1622)
B2V9T6 3.02e-36 125 47 2 138 3 smpB SsrA-binding protein Sulfurihydrogenibium sp. (strain YO3AOP1)
Q7V911 3.25e-36 125 47 1 141 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9313)
B3CQP3 3.25e-36 125 43 4 149 3 smpB SsrA-binding protein Orientia tsutsugamushi (strain Ikeda)
A8I0D5 3.31e-36 125 41 2 160 3 smpB SsrA-binding protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
C4L5G5 5.54e-36 125 41 1 151 3 smpB SsrA-binding protein Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8ENQ2 5.81e-36 125 42 2 150 3 smpB SsrA-binding protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7X2N6 6.49e-36 125 43 2 148 3 smpB SsrA-binding protein Sphingomonas elodea
A9KPF1 6.86e-36 124 41 1 141 3 smpB SsrA-binding protein Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q3A3J2 7.11e-36 124 44 1 147 3 smpB SsrA-binding protein Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A6X299 7.79e-36 124 40 2 157 3 smpB SsrA-binding protein Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5CCM6 8.84e-36 124 42 4 149 3 smpB SsrA-binding protein Orientia tsutsugamushi (strain Boryong)
Q24MW8 9.03e-36 124 41 1 151 3 smpB SsrA-binding protein Desulfitobacterium hafniense (strain Y51)
B8FXV6 9.03e-36 124 41 1 151 3 smpB SsrA-binding protein Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A1VFF3 1.21e-35 124 44 2 153 3 smpB SsrA-binding protein Nitratidesulfovibrio vulgaris (strain DP4)
Q72DV1 1.21e-35 124 44 2 153 3 smpB SsrA-binding protein Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A2C637 1.45e-35 124 46 1 141 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9303)
A1A0L5 1.46e-35 124 44 2 156 3 smpB SsrA-binding protein Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
P66859 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella suis biovar 1 (strain 1330)
B0CKX3 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella suis (strain ATCC 23445 / NCTC 10510)
P66858 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHY9 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella melitensis biotype 2 (strain ATCC 23457)
A9MA22 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57E95 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella abortus biovar 1 (strain 9-941)
Q2YMY0 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella abortus (strain 2308)
B2SAC5 1.46e-35 124 40 2 157 3 smpB SsrA-binding protein Brucella abortus (strain S19)
Q97L49 1.48e-35 124 44 1 145 3 smpB SsrA-binding protein Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6Q776 1.56e-35 124 47 2 141 3 smpB SsrA-binding protein Sulfurovum sp. (strain NBC37-1)
B9MNR6 1.98e-35 123 43 1 148 3 smpB SsrA-binding protein Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q3B0J2 2.48e-35 123 44 0 135 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9902)
A7GZ96 2.77e-35 123 43 1 144 3 smpB SsrA-binding protein Campylobacter curvus (strain 525.92)
Q2G8D5 3.04e-35 123 44 3 150 3 smpB SsrA-binding protein Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
C4XJ76 3.14e-35 123 43 1 148 3 smpB SsrA-binding protein Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q03SK9 3.25e-35 123 42 1 157 3 smpB SsrA-binding protein Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A4XIH3 4.78e-35 122 43 1 148 3 smpB SsrA-binding protein Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q214K5 4.85e-35 122 41 2 148 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisB18)
A9NF97 6.08e-35 122 43 1 143 3 smpB SsrA-binding protein Acholeplasma laidlawii (strain PG-8A)
A7IM13 6.41e-35 122 43 3 160 3 smpB SsrA-binding protein Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P43659 6.51e-35 122 42 2 149 3 smpB SsrA-binding protein Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
B1I1B6 7.13e-35 122 46 1 141 3 smpB SsrA-binding protein Desulforudis audaxviator (strain MP104C)
B9KMM4 7.5e-35 122 44 3 152 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZG8 7.5e-35 122 44 3 152 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PMS9 7.5e-35 122 44 3 152 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A5V3L8 7.57e-35 122 42 2 148 3 smpB SsrA-binding protein Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5CYM8 8.4e-35 122 44 2 142 3 smpB SsrA-binding protein Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A4VW67 1.06e-34 121 44 1 144 3 smpB SsrA-binding protein Streptococcus suis (strain 05ZYH33)
A4W2H3 1.06e-34 121 44 1 144 3 smpB SsrA-binding protein Streptococcus suis (strain 98HAH33)
Q3AND9 1.31e-34 122 45 0 137 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9605)
A8EWH6 1.31e-34 121 41 1 141 3 smpB SsrA-binding protein Aliarcobacter butzleri (strain RM4018)
A4J8T4 1.34e-34 121 42 2 157 3 smpB SsrA-binding protein Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C0QUM8 1.37e-34 121 45 1 139 3 smpB SsrA-binding protein Persephonella marina (strain DSM 14350 / EX-H1)
A7HX37 1.59e-34 121 42 3 158 3 smpB SsrA-binding protein Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5EKM6 1.75e-34 121 41 2 153 3 smpB SsrA-binding protein Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q3AFC2 2.34e-34 120 43 2 142 3 smpB SsrA-binding protein Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A0LVP0 2.51e-34 120 43 1 150 3 smpB SsrA-binding protein Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A4YWD7 2.85e-34 120 40 2 154 3 smpB SsrA-binding protein Bradyrhizobium sp. (strain ORS 278)
Q6G467 2.9e-34 120 40 2 157 3 smpB SsrA-binding protein Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q28WG4 3.35e-34 120 40 2 157 3 smpB SsrA-binding protein Jannaschia sp. (strain CCS1)
Q03LI8 3.96e-34 120 42 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M570 3.96e-34 120 42 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0N4 3.96e-34 120 42 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain CNRZ 1066)
Q0IDW2 4.52e-34 120 44 0 132 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9311)
B5XK94 4.54e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M49 (strain NZ131)
Q48UT9 4.54e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JI42 4.54e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XDD6 4.54e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9A126 4.54e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M1
Q7U9W8 4.68e-34 120 43 0 135 3 smpB SsrA-binding protein Parasynechococcus marenigrum (strain WH8102)
A9IRK6 5.45e-34 120 40 2 157 3 smpB SsrA-binding protein Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G090 5.76e-34 120 39 2 157 3 smpB SsrA-binding protein Bartonella quintana (strain Toulouse)
P0DF81 6.15e-34 119 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF80 6.15e-34 119 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A9BD59 7.07e-34 120 46 0 128 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9211)
A5VPI6 7.31e-34 119 39 2 157 3 smpB SsrA-binding protein Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C0MAA1 7.4e-34 119 43 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. equi (strain 4047)
Q985B9 7.77e-34 119 38 2 160 3 smpB SsrA-binding protein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q7VJX1 8.9e-34 119 42 2 150 3 smpB SsrA-binding protein Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6NIL8 9.71e-34 119 47 3 136 3 smpB SsrA-binding protein Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A9G109 1.01e-33 119 41 3 161 3 smpB SsrA-binding protein Sorangium cellulosum (strain So ce56)
B4U434 1.08e-33 119 42 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q318C5 1.17e-33 119 42 0 143 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9312)
C0MCH3 1.26e-33 119 42 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. zooepidemicus (strain H70)
A3PFA6 1.27e-33 119 44 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9301)
Q1GDQ2 1.36e-33 119 41 3 160 3 smpB SsrA-binding protein Ruegeria sp. (strain TM1040)
A5GI45 1.36e-33 119 43 0 132 3 smpB SsrA-binding protein Synechococcus sp. (strain WH7803)
Q16BP2 1.38e-33 119 41 2 152 3 smpB SsrA-binding protein Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A2BTJ8 1.68e-33 119 45 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain AS9601)
Q184Z6 1.76e-33 119 43 2 144 3 smpB SsrA-binding protein Clostridioides difficile (strain 630)
A0LDB8 1.94e-33 118 44 1 143 3 smpB SsrA-binding protein Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
P66865 1.97e-33 118 42 1 145 3 smpB SsrA-binding protein Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66864 1.97e-33 118 42 1 145 3 smpB SsrA-binding protein Streptococcus agalactiae serotype III (strain NEM316)
Q3K035 1.97e-33 118 42 1 145 3 smpB SsrA-binding protein Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q2JV45 1.98e-33 118 47 0 148 3 smpB SsrA-binding protein Synechococcus sp. (strain JA-3-3Ab)
Q1JMZ7 1.99e-33 118 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD22 1.99e-33 118 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q2GCW3 2.37e-33 118 45 3 144 3 smpB SsrA-binding protein Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q5FLT4 2.49e-33 118 45 1 135 3 smpB SsrA-binding protein Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A7HGZ0 2.58e-33 118 44 1 140 3 smpB SsrA-binding protein Anaeromyxobacter sp. (strain Fw109-5)
B9DTZ7 2.73e-33 118 42 1 143 3 smpB SsrA-binding protein Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q1J7Y3 2.79e-33 118 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M4 (strain MGAS10750)
B6JGA6 2.79e-33 118 40 4 160 3 smpB SsrA-binding protein Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B3CPW2 3.36e-33 117 44 2 146 3 smpB SsrA-binding protein Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A5FZS6 3.44e-33 118 43 2 144 3 smpB SsrA-binding protein Acidiphilium cryptum (strain JF-5)
Q2KAF1 3.48e-33 118 40 2 160 3 smpB SsrA-binding protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PUN0 3.48e-33 118 40 2 160 3 smpB SsrA-binding protein Rhizobium etli (strain CIAT 652)
Q2JM08 4.32e-33 117 47 0 148 3 smpB SsrA-binding protein Synechococcus sp. (strain JA-2-3B'a(2-13))
A2RFZ7 4.54e-33 117 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M5 (strain Manfredo)
Q7V9Q3 4.64e-33 117 42 0 128 3 smpB SsrA-binding protein Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8RB39 4.94e-33 117 45 1 135 3 smpB SsrA-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A8GWS0 5.04e-33 117 41 3 147 3 smpB SsrA-binding protein Rickettsia bellii (strain OSU 85-389)
P9WGD3 5.41e-33 117 41 2 156 1 smpB SsrA-binding protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGD2 5.41e-33 117 41 2 156 3 smpB SsrA-binding protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U7B5 5.41e-33 117 41 2 156 3 smpB SsrA-binding protein Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AGL9 5.41e-33 117 41 2 156 3 smpB SsrA-binding protein Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KN98 5.41e-33 117 41 2 156 3 smpB SsrA-binding protein Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A613 5.41e-33 117 41 2 156 3 smpB SsrA-binding protein Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1RIJ4 5.41e-33 117 41 3 147 3 smpB SsrA-binding protein Rickettsia bellii (strain RML369-C)
Q9RH74 5.97e-33 117 40 2 148 3 smpB SsrA-binding protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q4JX42 6.38e-33 118 42 3 153 3 smpB SsrA-binding protein Corynebacterium jeikeium (strain K411)
Q2RLS9 7.4e-33 117 43 2 141 3 smpB SsrA-binding protein Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8FRE7 7.85e-33 117 43 2 145 3 smpB SsrA-binding protein Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A8YTT9 8.82e-33 116 45 1 135 3 smpB SsrA-binding protein Lactobacillus helveticus (strain DPC 4571)
Q6AEL7 9.28e-33 117 42 3 159 3 smpB SsrA-binding protein Leifsonia xyli subsp. xyli (strain CTCB07)
A6TU24 9.42e-33 116 39 2 151 3 smpB SsrA-binding protein Alkaliphilus metalliredigens (strain QYMF)
C0R392 9.53e-33 116 43 3 148 3 smpB SsrA-binding protein Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73H09 9.53e-33 116 43 3 148 3 smpB SsrA-binding protein Wolbachia pipientis wMel
Q3Z6E3 9.6e-33 117 39 1 151 3 smpB SsrA-binding protein Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q0BYG5 1.03e-32 117 43 2 144 3 smpB SsrA-binding protein Hyphomonas neptunium (strain ATCC 15444)
Q07M67 1.07e-32 116 41 2 148 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisA53)
Q1MRU5 1.08e-32 116 41 1 146 3 smpB SsrA-binding protein Lawsonia intracellularis (strain PHE/MN1-00)
Q03GW2 1.14e-32 116 43 3 151 3 smpB SsrA-binding protein Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q1QL45 1.25e-32 116 40 2 148 3 smpB SsrA-binding protein Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B1L9P9 1.4e-32 116 43 2 147 3 smpB SsrA-binding protein Thermotoga sp. (strain RQ2)
A5IKG7 1.4e-32 116 43 2 147 3 smpB SsrA-binding protein Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
P56944 1.4e-32 116 43 2 147 1 smpB SsrA-binding protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q03VG0 1.49e-32 116 38 2 157 3 smpB SsrA-binding protein Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01880
Feature type CDS
Gene smpB
Product SsrA-binding protein SmpB
Location 410416 - 410898 (strand: 1)
Length 483 (nucleotides) / 160 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2338
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01668 SmpB protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0691 Posttranslational modification, protein turnover, chaperones (O) O tmRNA-binding protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03664 SsrA-binding protein - -

Protein Sequence

MTKKKAHKPGSATIALNKRARHDYFIEEEMEAGLALQGWEVKSLRAGKANLGDSYVILRDGEAYLFGANFTPLSVASSHVVCDPTRTRKLLLNKRELDTLFGKVNRDGHTVIALSLYWKNAWCKVKIGIAKGKKEHDKRDDIRDREWKVDKARIMKHAGR

Flanking regions ( +/- flanking 50bp)

ATAAATAAGCAATTTATTTCATGTGCGCATAACGTATAATAGCGACCATTATGACAAAGAAAAAAGCTCACAAACCAGGCTCTGCCACCATTGCGCTCAATAAACGCGCCCGCCACGACTACTTTATCGAAGAAGAGATGGAAGCGGGTCTGGCGCTGCAAGGTTGGGAGGTCAAATCCTTACGTGCAGGTAAAGCGAACCTCGGCGATAGTTACGTGATCCTGCGTGACGGCGAGGCTTACCTGTTTGGTGCAAACTTTACGCCGCTCAGTGTGGCGTCATCTCACGTTGTCTGCGATCCGACGCGGACACGTAAGTTACTGCTGAACAAACGGGAACTCGATACCTTGTTCGGTAAAGTTAATCGGGACGGACACACCGTCATCGCATTGTCGCTCTACTGGAAAAATGCCTGGTGCAAAGTCAAAATCGGCATTGCCAAAGGTAAGAAAGAGCATGACAAGCGCGATGACATCAGAGATCGTGAGTGGAAAGTAGACAAAGCAAGAATTATGAAGCATGCCGGCCGTTAAGTACTGGTATTCTTCACTAATTTTCTGATATACTCTGTTCAACAACTTGG