Homologs in group_2371

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18350 FBDBKF_18350 100.0 Morganella morganii S1 smpB SsrA-binding protein SmpB
EHELCC_18385 EHELCC_18385 100.0 Morganella morganii S2 smpB SsrA-binding protein SmpB
NLDBIP_18310 NLDBIP_18310 100.0 Morganella morganii S4 smpB SsrA-binding protein SmpB
LHKJJB_18505 LHKJJB_18505 100.0 Morganella morganii S3 smpB SsrA-binding protein SmpB
F4V73_RS01880 F4V73_RS01880 93.8 Morganella psychrotolerans smpB SsrA-binding protein SmpB
PMI_RS09405 PMI_RS09405 84.4 Proteus mirabilis HI4320 smpB SsrA-binding protein SmpB

Distribution of the homologs in the orthogroup group_2371

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2371

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A9MGS5 3.64e-107 305 88 0 160 3 smpB SsrA-binding protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P0A2G1 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2G2 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella typhi
B4TS67 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella schwarzengrund (strain CVM19633)
B5BEA6 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella paratyphi A (strain AKU_12601)
C0PW29 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella paratyphi C (strain RKS4594)
A9MZ63 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFG2 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2C5 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella newport (strain SL254)
B4TE63 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella heidelberg (strain SL476)
B5RD96 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUH5 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella enteritidis PT4 (strain P125109)
Q57L18 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella choleraesuis (strain SC-B67)
B5F2A0 2.6e-106 303 88 0 160 3 smpB SsrA-binding protein Salmonella agona (strain SL483)
A7MHX6 3.27e-106 303 88 0 160 3 smpB SsrA-binding protein Cronobacter sakazakii (strain ATCC BAA-894)
A8ANF2 4.6e-106 302 86 0 160 3 smpB SsrA-binding protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TCM7 4.55e-105 300 86 0 160 3 smpB SsrA-binding protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVJ3 4.55e-105 300 86 0 160 3 smpB SsrA-binding protein Klebsiella pneumoniae (strain 342)
Q3YYQ2 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Shigella sonnei (strain Ss046)
P0A835 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Shigella flexneri
Q0T186 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Shigella flexneri serotype 5b (strain 8401)
Q32CW9 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31XC6 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Shigella boydii serotype 4 (strain Sb227)
B2TYP2 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUV4 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8A4 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain UTI89 / UPEC)
B1LPC7 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain SMS-3-5 / SECEC)
B6I641 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain SE11)
B7N6K5 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A832 3.21e-104 298 86 0 160 1 smpB SsrA-binding protein Escherichia coli (strain K12)
B1IVL4 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A833 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AEE9 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O1:K1 / APEC
A8A3C6 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O9:H4 (strain HS)
B1XBU0 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain K12 / DH10B)
C4ZYN7 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7M989 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O8 (strain IAI1)
B7MYQ8 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O81 (strain ED1a)
B7NSB8 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z237 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A834 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O157:H7
B7LDK8 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli (strain 55989 / EAEC)
B7MIV7 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH68 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQ60 3.21e-104 298 86 0 160 3 smpB SsrA-binding protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TEM0 8.81e-104 296 85 0 160 3 smpB SsrA-binding protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A4WDI4 9.72e-104 296 86 0 160 3 smpB SsrA-binding protein Enterobacter sp. (strain 638)
Q7N1U1 5.22e-101 290 83 0 160 3 smpB SsrA-binding protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4F065 7.42e-101 289 84 0 160 3 smpB SsrA-binding protein Proteus mirabilis (strain HI4320)
Q2NRZ6 1.58e-99 286 82 0 160 3 smpB SsrA-binding protein Sodalis glossinidius (strain morsitans)
B2VEC0 3.89e-99 285 81 0 160 3 smpB SsrA-binding protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q66DB4 1.33e-97 281 81 0 160 3 smpB SsrA-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNV2 1.33e-97 281 81 0 160 3 smpB SsrA-binding protein Yersinia pestis (strain Pestoides F)
Q1CFK6 1.33e-97 281 81 0 160 3 smpB SsrA-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH14 1.33e-97 281 81 0 160 3 smpB SsrA-binding protein Yersinia pestis
Q1CAH5 1.33e-97 281 81 0 160 3 smpB SsrA-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKS8 1.33e-97 281 81 0 160 3 smpB SsrA-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JKI0 1.85e-97 280 82 0 160 3 smpB SsrA-binding protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BAL3 9.7e-97 279 80 0 160 3 smpB SsrA-binding protein Edwardsiella ictaluri (strain 93-146)
C6D970 1.55e-96 278 81 0 160 3 smpB SsrA-binding protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D8Y5 1.85e-95 275 80 0 160 3 smpB SsrA-binding protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q65SE8 1.76e-94 273 79 1 160 3 smpB SsrA-binding protein Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A8GI46 3.28e-94 272 79 0 160 3 smpB SsrA-binding protein Serratia proteamaculans (strain 568)
P44967 2.29e-90 263 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UD90 2.29e-90 263 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain PittEE)
Q4QLS9 2.29e-90 263 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain 86-028NP)
A5UIC0 2.95e-90 262 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain PittGG)
B3H1K6 3.55e-89 259 79 0 153 3 smpB SsrA-binding protein Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0M7 3.55e-89 259 79 0 153 3 smpB SsrA-binding protein Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VMQ1 3.96e-89 259 78 1 160 3 smpB SsrA-binding protein Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F4Q7 1.2e-88 258 77 1 160 3 smpB SsrA-binding protein Glaesserella parasuis serovar 5 (strain SH0165)
Q7VM64 1.32e-88 258 80 0 153 3 smpB SsrA-binding protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P57827 1.34e-86 253 75 1 158 3 smpB SsrA-binding protein Pasteurella multocida (strain Pm70)
C4K4E2 1.69e-86 253 71 0 160 3 smpB SsrA-binding protein Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0USL1 6.56e-86 251 75 1 160 3 smpB SsrA-binding protein Histophilus somni (strain 2336)
Q0I279 6.56e-86 251 75 1 160 3 smpB SsrA-binding protein Histophilus somni (strain 129Pt)
C4L8Z2 7.96e-80 236 68 0 160 3 smpB SsrA-binding protein Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A0KI80 2.06e-77 230 68 1 161 3 smpB SsrA-binding protein Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87RY2 7.91e-75 223 65 0 158 3 smpB SsrA-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LT98 1.32e-74 223 64 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain M66-2)
P52116 1.32e-74 223 64 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F375 1.32e-74 223 64 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SPV7 4.42e-74 221 65 1 161 3 smpB SsrA-binding protein Aeromonas salmonicida (strain A449)
A7MWX4 1.86e-73 220 63 0 158 3 smpB SsrA-binding protein Vibrio campbellii (strain ATCC BAA-1116)
A1SV84 4.66e-73 219 65 0 153 3 smpB SsrA-binding protein Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A3QCE0 2.54e-71 214 66 1 150 3 smpB SsrA-binding protein Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B6EKA9 3.19e-71 214 60 0 158 3 smpB SsrA-binding protein Aliivibrio salmonicida (strain LFI1238)
B5FA19 1.06e-69 210 59 0 158 3 smpB SsrA-binding protein Aliivibrio fischeri (strain MJ11)
Q5E399 1.68e-69 210 58 0 158 3 smpB SsrA-binding protein Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5QW47 6.17e-68 206 58 1 160 3 smpB SsrA-binding protein Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6LUB4 3.6e-67 204 60 1 155 3 smpB SsrA-binding protein Photobacterium profundum (strain SS9)
Q7MN99 5.7e-67 203 65 1 159 3 smpB SsrA-binding protein Vibrio vulnificus (strain YJ016)
Q8DF53 5.7e-67 203 65 1 159 3 smpB SsrA-binding protein Vibrio vulnificus (strain CMCP6)
A8H222 2.64e-66 202 60 2 161 3 smpB SsrA-binding protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLG2 2.64e-66 202 60 2 161 3 smpB SsrA-binding protein Shewanella halifaxensis (strain HAW-EB4)
Q15V28 3.15e-66 201 59 0 155 3 smpB SsrA-binding protein Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A8FT45 1.91e-65 200 62 1 146 3 smpB SsrA-binding protein Shewanella sediminis (strain HAW-EB3)
B1KKG8 7.43e-65 198 61 1 146 3 smpB SsrA-binding protein Shewanella woodyi (strain ATCC 51908 / MS32)
Q3IE36 2.43e-64 197 56 0 157 3 smpB SsrA-binding protein Pseudoalteromonas translucida (strain TAC 125)
Q12PV1 3.63e-64 196 60 2 159 3 smpB SsrA-binding protein Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q604C6 1.09e-63 195 58 1 156 3 smpB SsrA-binding protein Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1S886 1.63e-63 195 60 2 155 3 smpB SsrA-binding protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q085W8 2.24e-63 194 59 2 157 3 smpB SsrA-binding protein Shewanella frigidimarina (strain NCIMB 400)
Q0HSR7 8.22e-63 193 56 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain MR-7)
Q8EGW8 8.22e-63 193 56 1 157 3 smpB SsrA-binding protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HGH0 1.75e-62 192 56 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain MR-4)
A0KZF9 1.75e-62 192 56 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain ANA-3)
Q1IF66 3.09e-62 191 58 1 160 3 smpB SsrA-binding protein Pseudomonas entomophila (strain L48)
A4VPR2 7.26e-62 191 60 1 160 3 smpB SsrA-binding protein Stutzerimonas stutzeri (strain A1501)
Q5WSX5 8.21e-62 190 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Lens)
Q5X148 8.21e-62 190 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Paris)
A1U622 8.75e-62 190 57 0 159 3 smpB SsrA-binding protein Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5ZRP1 1.02e-61 190 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5II10 1.02e-61 190 62 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Corby)
Q88DT6 2.47e-61 189 58 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9A9 2.47e-61 189 58 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q47XH8 4.04e-61 189 55 0 145 3 smpB SsrA-binding protein Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B4RXY7 4.05e-61 189 53 0 158 3 smpB SsrA-binding protein Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0KIT1 8.99e-61 188 58 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain GB-1)
B1J247 4.9e-60 186 56 1 160 3 smpB SsrA-binding protein Pseudomonas putida (strain W619)
A4XYG4 8.2e-60 185 58 1 160 3 smpB SsrA-binding protein Pseudomonas mendocina (strain ymp)
Q4KIH9 9.04e-60 185 56 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0VSU5 1.28e-59 185 57 1 154 3 smpB SsrA-binding protein Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6F8J9 1.29e-59 185 58 0 150 3 smpB SsrA-binding protein Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8KTI4 4.57e-59 183 57 1 160 3 smpB SsrA-binding protein Azotobacter vinelandii
C1DFN0 4.57e-59 183 57 1 160 3 smpB SsrA-binding protein Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0V8G6 1.16e-58 182 58 0 150 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AYE)
A3M2Y4 1.16e-58 182 58 0 150 3 smpB SsrA-binding protein Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HUN4 1.16e-58 182 58 0 150 3 smpB SsrA-binding protein Acinetobacter baumannii (strain ACICU)
B7I7Q2 1.16e-58 182 58 0 150 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AB0057)
B7GYP8 1.16e-58 182 58 0 150 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AB307-0294)
C5BQH7 1.4e-58 182 57 1 160 3 smpB SsrA-binding protein Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WX40 2.42e-58 182 57 0 145 3 smpB SsrA-binding protein Halorhodospira halophila (strain DSM 244 / SL1)
Q9HV40 3.73e-58 181 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FQ4 3.73e-58 181 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1I0 3.73e-58 181 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain LESB58)
A6VCM5 3.73e-58 181 57 1 157 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain PA7)
B0U3K6 1.44e-57 180 57 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain M12)
A5WH04 2.42e-57 179 55 1 154 3 smpB SsrA-binding protein Psychrobacter sp. (strain PRwf-1)
Q2SMN6 2.53e-57 179 57 1 156 3 smpB SsrA-binding protein Hahella chejuensis (strain KCTC 2396)
Q87WN1 2.61e-57 179 56 1 160 3 smpB SsrA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4FUW4 4.33e-57 178 54 1 153 3 smpB SsrA-binding protein Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B4SS56 4.94e-57 179 54 0 148 3 smpB SsrA-binding protein Stenotrophomonas maltophilia (strain R551-3)
Q0A7D4 8.6e-57 177 54 1 157 3 smpB SsrA-binding protein Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9PAZ7 9.52e-57 178 56 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain 9a5c)
Q87BS0 1.02e-56 178 57 0 144 3 smpB SsrA-binding protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6G4 1.02e-56 178 57 0 144 3 smpB SsrA-binding protein Xylella fastidiosa (strain M23)
B2FMX5 1.12e-56 177 54 0 148 3 smpB SsrA-binding protein Stenotrophomonas maltophilia (strain K279a)
A6W2E0 1.14e-56 177 53 0 157 3 smpB SsrA-binding protein Marinomonas sp. (strain MWYL1)
Q4ZNN9 1.59e-56 177 56 1 160 3 smpB SsrA-binding protein Pseudomonas syringae pv. syringae (strain B728a)
A1RLZ8 1.74e-56 177 57 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain W3-18-1)
A4Y4S4 1.74e-56 177 57 1 157 3 smpB SsrA-binding protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q1QDW1 1.77e-56 177 54 1 153 3 smpB SsrA-binding protein Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A9KGA3 2.6e-56 176 51 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain Dugway 5J108-111)
B6IZH7 2.6e-56 176 51 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain CbuG_Q212)
Q48E54 3.85e-56 176 55 0 156 3 smpB SsrA-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3KIA8 6.79e-56 175 55 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain Pf0-1)
A9KTG8 8.89e-56 175 56 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS195)
A6WKV9 8.89e-56 175 56 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS185)
A3D262 8.89e-56 175 56 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EAZ5 8.89e-56 175 56 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS223)
Q83C29 9.23e-56 175 51 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A1AW41 9.47e-56 175 55 0 147 3 smpB SsrA-binding protein Ruthia magnifica subsp. Calyptogena magnifica
B6J7W1 1.35e-55 174 50 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain CbuK_Q154)
Q31FR9 1.36e-55 174 56 1 155 3 smpB SsrA-binding protein Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5CX31 1.46e-55 174 55 0 154 3 smpB SsrA-binding protein Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A9N8I5 3.14e-55 174 50 0 159 3 smpB SsrA-binding protein Coxiella burnetii (strain RSA 331 / Henzerling II)
C3K282 5.79e-55 173 54 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain SBW25)
Q21H28 3.22e-54 171 53 0 151 3 smpB SsrA-binding protein Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8PAL7 5.45e-54 171 52 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVV0 5.45e-54 171 52 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain B100)
Q4UT03 5.45e-54 171 52 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain 8004)
Q1QSW3 6.09e-54 170 53 0 147 3 smpB SsrA-binding protein Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5H194 3.38e-53 169 51 0 151 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQV2 3.38e-53 169 51 0 151 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P468 3.73e-53 169 51 0 151 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PMB9 4.39e-53 169 51 0 151 3 smpB SsrA-binding protein Xanthomonas axonopodis pv. citri (strain 306)
Q3BVC6 7.92e-53 168 51 0 151 3 smpB SsrA-binding protein Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2Y9R5 8.6e-53 167 52 0 144 3 smpB SsrA-binding protein Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1LSR7 9.51e-53 167 59 0 149 3 smpB SsrA-binding protein Baumannia cicadellinicola subsp. Homalodisca coagulata
B3PF48 2.42e-52 166 52 0 157 3 smpB SsrA-binding protein Cellvibrio japonicus (strain Ueda107)
B0TY34 9.6e-52 165 53 0 154 3 smpB SsrA-binding protein Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q3JBU6 1.95e-51 165 52 0 144 3 smpB SsrA-binding protein Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4IYL4 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFP4 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BMI2 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain OSU18)
B2SGA3 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A446 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain LVS)
A7NBC7 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14H46 8.26e-51 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain FSC 198)
A1K5T8 8.94e-51 162 51 0 144 3 smpB SsrA-binding protein Azoarcus sp. (strain BH72)
A0Q735 1.44e-50 162 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. novicida (strain U112)
B3R297 1.61e-50 161 52 0 144 3 smpB SsrA-binding protein Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8XZH1 1.63e-50 161 52 0 144 3 smpB SsrA-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q47DK3 2.12e-50 161 50 0 148 3 smpB SsrA-binding protein Dechloromonas aromatica (strain RCB)
Q82X65 2.65e-50 161 47 0 144 3 smpB SsrA-binding protein Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0KA36 2.96e-50 160 52 0 144 3 smpB SsrA-binding protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q2L136 4.14e-50 160 51 0 148 3 smpB SsrA-binding protein Bordetella avium (strain 197N)
Q5NYE0 4.65e-50 160 52 0 144 3 smpB SsrA-binding protein Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0AIG7 4.96e-50 160 49 0 144 3 smpB SsrA-binding protein Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A5EXZ5 7.23e-50 160 50 0 143 3 smpB SsrA-binding protein Dichelobacter nodosus (strain VCS1703A)
B2UBC4 1.95e-49 159 51 0 144 3 smpB SsrA-binding protein Ralstonia pickettii (strain 12J)
Q3SI24 2.19e-49 159 49 0 146 3 smpB SsrA-binding protein Thiobacillus denitrificans (strain ATCC 25259)
A1WPQ3 2.47e-49 159 50 2 161 3 smpB SsrA-binding protein Verminephrobacter eiseniae (strain EF01-2)
A1W8Y5 2.91e-49 159 52 0 146 3 smpB SsrA-binding protein Acidovorax sp. (strain JS42)
B9MGQ0 2.91e-49 159 52 0 146 3 smpB SsrA-binding protein Acidovorax ebreus (strain TPSY)
Q1LND7 2.94e-49 158 52 0 144 3 smpB SsrA-binding protein Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7VYA8 4.32e-49 158 48 0 148 3 smpB SsrA-binding protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WJ73 4.32e-49 158 48 0 148 3 smpB SsrA-binding protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WA41 4.87e-49 158 48 0 148 3 smpB SsrA-binding protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A4SYS6 5.19e-49 157 51 0 144 3 smpB SsrA-binding protein Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q7NSG2 6.73e-49 157 50 0 145 3 smpB SsrA-binding protein Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q470F7 9.57e-49 157 51 0 144 3 smpB SsrA-binding protein Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q21VE0 1.35e-48 157 50 1 150 3 smpB SsrA-binding protein Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q13XD6 1.04e-47 154 46 0 147 3 smpB SsrA-binding protein Paraburkholderia xenovorans (strain LB400)
Q1H274 5.95e-47 152 48 0 144 3 smpB SsrA-binding protein Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1TSJ4 1e-46 152 50 1 150 3 smpB SsrA-binding protein Paracidovorax citrulli (strain AAC00-1)
B8D7F1 1.12e-46 152 45 0 145 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57342 1.12e-46 152 45 0 145 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D947 1.12e-46 152 45 0 145 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q2SWX6 1.28e-46 151 48 0 146 3 smpB SsrA-binding protein Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B1Y225 1.54e-46 151 47 0 145 3 smpB SsrA-binding protein Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q63T34 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain K96243)
A3NAS3 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 668)
Q3JR53 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 1710b)
A3NWK5 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 1106a)
A1V545 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain SAVP1)
Q62JE7 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain ATCC 23344)
A2SB97 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain NCTC 10229)
A3MKR8 2.78e-46 150 48 0 146 3 smpB SsrA-binding protein Burkholderia mallei (strain NCTC 10247)
A1KUW3 4.03e-46 150 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0Y8 4.03e-46 150 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Y7 4.03e-46 150 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M0W1 4.03e-46 150 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup C (strain 053442)
Q12AT7 4.68e-46 150 50 0 147 3 smpB SsrA-binding protein Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4JF55 1.14e-45 149 47 0 144 3 smpB SsrA-binding protein Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BHG2 1.14e-45 149 47 0 144 3 smpB SsrA-binding protein Burkholderia orbicola (strain AU 1054)
A0K8C3 1.14e-45 149 47 0 144 3 smpB SsrA-binding protein Burkholderia cenocepacia (strain HI2424)
Q0BE35 1.8e-45 149 47 0 144 3 smpB SsrA-binding protein Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39F63 1.88e-45 149 47 0 144 3 smpB SsrA-binding protein Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5F816 3.42e-45 148 48 0 145 3 smpB SsrA-binding protein Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A2SG89 1.38e-44 147 47 0 144 3 smpB SsrA-binding protein Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1ANL4 5.66e-44 145 47 1 151 3 smpB SsrA-binding protein Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q39V47 1.24e-43 144 49 2 151 3 smpB SsrA-binding protein Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5UPS2 3.45e-43 143 47 0 148 3 smpB SsrA-binding protein Roseiflexus sp. (strain RS-1)
Q74CG4 6.87e-43 142 47 2 151 3 smpB SsrA-binding protein Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B0JTG1 9e-43 142 47 0 143 3 smpB SsrA-binding protein Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q2RT81 2.01e-42 141 49 1 147 3 smpB SsrA-binding protein Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5G3A5 2.1e-42 141 47 2 149 3 smpB SsrA-binding protein Geotalea uraniireducens (strain Rf4)
A4ISN8 2.47e-42 141 47 1 144 3 smpB SsrA-binding protein Geobacillus thermodenitrificans (strain NG80-2)
Q5WDM4 4.75e-42 140 45 1 148 3 smpB SsrA-binding protein Shouchella clausii (strain KSM-K16)
Q5KVF8 5.66e-42 140 47 1 144 3 smpB SsrA-binding protein Geobacillus kaustophilus (strain HTA426)
B8H482 6.1e-42 140 49 2 147 1 smpB SsrA-binding protein Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8Z9 6.1e-42 140 49 2 147 3 smpB SsrA-binding protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2N9K0 6.17e-42 140 48 2 148 3 smpB SsrA-binding protein Erythrobacter litoralis (strain HTCC2594)
C5D7L7 1.2e-41 139 48 1 143 3 smpB SsrA-binding protein Geobacillus sp. (strain WCH70)
B1HWE9 2.14e-41 138 45 1 149 3 smpB SsrA-binding protein Lysinibacillus sphaericus (strain C3-41)
B2TPV9 2.9e-41 138 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Eklund 17B / Type B)
B2UY12 2.9e-41 138 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Alaska E43 / Type E3)
Q89AM9 3.28e-41 138 41 1 156 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B9EAH5 4.37e-41 137 46 1 144 3 smpB SsrA-binding protein Macrococcus caseolyticus (strain JCSC5402)
Q313K7 4.59e-41 137 48 3 158 3 smpB SsrA-binding protein Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B7GLX3 5.85e-41 137 47 1 143 3 smpB SsrA-binding protein Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q9K721 6.11e-41 137 45 1 147 3 smpB SsrA-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8K9R5 1.25e-40 137 44 1 148 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A3DJ18 1.27e-40 136 49 1 134 3 smpB SsrA-binding protein Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2J722 1.38e-40 136 46 0 147 3 smpB SsrA-binding protein Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A0PYP8 1.73e-40 136 48 1 148 3 smpB SsrA-binding protein Clostridium novyi (strain NT)
A7NS28 2.81e-40 135 45 0 148 3 smpB SsrA-binding protein Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5N2N2 3.43e-40 135 47 1 154 3 smpB SsrA-binding protein Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E6A8 3.43e-40 135 47 1 154 3 smpB SsrA-binding protein Clostridium kluyveri (strain NBRC 12016)
B1KTK2 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Loch Maree / Type A3)
A7G9Y7 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IDC3 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Okra / Type B1)
C1FQX0 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Kyoto / Type A2)
A5HYC7 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KZ53 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain 657 / Type Ba4)
A7FQP4 4.23e-40 135 46 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain ATCC 19397 / Type A)
B9DJK4 5.55e-40 135 44 2 156 3 smpB SsrA-binding protein Staphylococcus carnosus (strain TM300)
A8FHG7 5.93e-40 135 45 1 144 3 smpB SsrA-binding protein Bacillus pumilus (strain SAFR-032)
Q8YM70 1.07e-39 134 46 0 145 3 smpB SsrA-binding protein Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3MAP3 2.03e-39 133 46 0 145 3 smpB SsrA-binding protein Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B0T1M3 2.39e-39 133 47 2 147 3 smpB SsrA-binding protein Caulobacter sp. (strain K31)
B7KF17 2.79e-39 133 45 0 143 3 smpB SsrA-binding protein Gloeothece citriformis (strain PCC 7424)
Q8NXL2 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MW2)
A8Z1A9 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain USA300 / TCH1516)
Q6GB49 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MSSA476)
Q6GIK9 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MRSA252)
A6QF90 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Newman)
Q5HHN6 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain COL)
Q2YWK9 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G023 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIL2 4.05e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain USA300)
B9LD60 4.63e-39 132 44 1 158 3 smpB SsrA-binding protein Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WJ45 4.63e-39 132 44 1 158 3 smpB SsrA-binding protein Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P66863 5.38e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain N315)
P66862 5.38e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQY5 5.38e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain JH9)
A6TZR0 5.38e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain JH1)
A7WZT9 5.38e-39 132 46 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4FLS2 7.49e-39 132 44 1 145 3 smpB SsrA-binding protein Pelagibacter ubique (strain HTCC1062)
A8M3R4 8.01e-39 132 47 1 144 3 smpB SsrA-binding protein Salinispora arenicola (strain CNS-205)
B0BZP2 8.32e-39 132 47 0 144 3 smpB SsrA-binding protein Acaryochloris marina (strain MBIC 11017)
P59630 8.78e-39 132 44 2 149 3 smpB SsrA-binding protein Enterococcus faecalis (strain ATCC 700802 / V583)
Q8CPX9 9.12e-39 132 44 2 156 3 smpB SsrA-binding protein Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQU5 9.12e-39 132 44 2 156 3 smpB SsrA-binding protein Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A0ALD2 1.09e-38 132 44 1 143 3 smpB SsrA-binding protein Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66860 1.09e-38 132 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDA8 1.09e-38 132 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4a (strain HCC23)
Q71WX8 1.09e-38 132 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4b (strain F2365)
C1KY87 1.09e-38 132 44 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4b (strain CLIP80459)
P66861 1.09e-38 132 44 1 143 3 smpB SsrA-binding protein Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A4X3K9 1.1e-38 132 46 1 151 3 smpB SsrA-binding protein Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q67SL8 1.3e-38 131 46 3 147 3 smpB SsrA-binding protein Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q49W09 1.76e-38 131 46 3 156 3 smpB SsrA-binding protein Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7NKI3 1.85e-38 131 46 1 140 3 smpB SsrA-binding protein Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B7IP12 2e-38 131 45 1 144 3 smpB SsrA-binding protein Bacillus cereus (strain G9842)
Q1GSC9 3.07e-38 130 47 2 148 3 smpB SsrA-binding protein Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B8G4V8 3.53e-38 130 46 0 145 3 smpB SsrA-binding protein Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q2W477 4.92e-38 130 45 3 152 3 smpB SsrA-binding protein Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A6LR41 5.38e-38 130 44 1 153 3 smpB SsrA-binding protein Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A7GUR1 5.57e-38 130 42 1 149 3 smpB SsrA-binding protein Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q4L4L2 5.93e-38 130 44 2 156 3 smpB SsrA-binding protein Staphylococcus haemolyticus (strain JCSC1435)
B9J4L7 6.01e-38 130 44 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain Q1)
B7HW45 6.01e-38 130 44 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain AH187)
Q72XZ2 6.01e-38 130 44 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain ATCC 10987 / NRS 248)
Q898Q7 6.61e-38 130 45 1 151 3 smpB SsrA-binding protein Clostridium tetani (strain Massachusetts / E88)
B2G624 7.19e-38 129 41 1 157 3 smpB SsrA-binding protein Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIJ0 7.19e-38 129 41 1 157 3 smpB SsrA-binding protein Limosilactobacillus reuteri (strain DSM 20016)
Q88YG7 1.01e-37 129 42 2 157 3 smpB SsrA-binding protein Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q815L5 1.19e-37 129 45 1 144 3 smpB SsrA-binding protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HEC5 1.19e-37 129 45 1 144 3 smpB SsrA-binding protein Bacillus cereus (strain B4264)
Q30TF9 2.02e-37 128 44 1 145 3 smpB SsrA-binding protein Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P74355 2.25e-37 128 45 0 144 3 smpB SsrA-binding protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8I8G4 2.48e-37 128 44 1 153 3 smpB SsrA-binding protein Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A7Z8U4 3.1e-37 128 41 1 149 3 smpB SsrA-binding protein Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A9VQ41 3.66e-37 128 43 1 144 3 smpB SsrA-binding protein Bacillus mycoides (strain KBAB4)
Q1AVL3 3.72e-37 127 45 1 144 3 smpB SsrA-binding protein Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1DAN7 3.94e-37 128 45 2 151 3 smpB SsrA-binding protein Myxococcus xanthus (strain DK1622)
Q5NPL5 4.1e-37 128 44 2 150 3 smpB SsrA-binding protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
O32230 4.16e-37 127 41 1 149 1 smpB SsrA-binding protein Bacillus subtilis (strain 168)
A6Q524 4.24e-37 127 48 1 134 3 smpB SsrA-binding protein Nitratiruptor sp. (strain SB155-2)
Q7X2N6 6.62e-37 127 44 2 148 3 smpB SsrA-binding protein Sphingomonas elodea
B0KA44 7.24e-37 127 46 1 135 3 smpB SsrA-binding protein Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K718 7.4e-37 127 46 1 135 3 smpB SsrA-binding protein Thermoanaerobacter sp. (strain X514)
Q0STE4 8.72e-37 127 42 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain SM101 / Type A)
Q8XKU7 8.72e-37 127 42 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain 13 / Type A)
Q0TQZ6 8.72e-37 127 42 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q47M13 1e-36 127 45 2 156 3 smpB SsrA-binding protein Thermobifida fusca (strain YX)
B8CYF2 1.04e-36 127 45 1 130 3 smpB SsrA-binding protein Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q6HBG1 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q631M9 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain ZK / E33L)
C1EZ92 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain 03BB102)
B7JFF5 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus cereus (strain AH820)
Q81XA8 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus anthracis
A0RKR7 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus thuringiensis (strain Al Hakam)
C3LDE9 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P072 1.08e-36 126 42 1 149 3 smpB SsrA-binding protein Bacillus anthracis (strain A0248)
Q112L2 1.52e-36 126 43 0 148 3 smpB SsrA-binding protein Trichodesmium erythraeum (strain IMS101)
A0RNV4 1.58e-36 126 46 1 141 3 smpB SsrA-binding protein Campylobacter fetus subsp. fetus (strain 82-40)
A1VFF3 2.14e-36 125 45 2 153 3 smpB SsrA-binding protein Nitratidesulfovibrio vulgaris (strain DP4)
Q72DV1 2.14e-36 125 45 2 153 3 smpB SsrA-binding protein Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q5MZN2 2.36e-36 125 42 0 149 3 smpB SsrA-binding protein Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31M94 2.36e-36 125 42 0 149 3 smpB SsrA-binding protein Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2LU46 2.83e-36 125 47 3 144 3 smpB SsrA-binding protein Syntrophus aciditrophicus (strain SB)
B3CQP3 3.18e-36 125 45 4 148 3 smpB SsrA-binding protein Orientia tsutsugamushi (strain Ikeda)
B9MNR6 3.41e-36 125 43 1 148 3 smpB SsrA-binding protein Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q97L49 4.24e-36 125 45 1 145 3 smpB SsrA-binding protein Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A8EWH6 4.24e-36 125 42 1 141 3 smpB SsrA-binding protein Aliarcobacter butzleri (strain RM4018)
Q8DHM0 4.28e-36 125 44 0 145 3 smpB SsrA-binding protein Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A8I0D5 4.3e-36 125 41 2 160 3 smpB SsrA-binding protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B2V9T6 4.62e-36 125 47 2 138 3 smpB SsrA-binding protein Sulfurihydrogenibium sp. (strain YO3AOP1)
Q2G8D5 6.15e-36 125 45 3 150 3 smpB SsrA-binding protein Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A4XIH3 7.45e-36 124 43 1 148 3 smpB SsrA-binding protein Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A7GZ96 8.74e-36 124 43 1 144 3 smpB SsrA-binding protein Campylobacter curvus (strain 525.92)
A5CCM6 8.74e-36 124 44 4 148 3 smpB SsrA-binding protein Orientia tsutsugamushi (strain Boryong)
Q8ENQ2 8.78e-36 124 43 2 150 3 smpB SsrA-binding protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C4XJ76 9e-36 124 45 1 144 3 smpB SsrA-binding protein Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A8MFY7 1.07e-35 124 44 1 137 3 smpB SsrA-binding protein Alkaliphilus oremlandii (strain OhILAs)
Q0APB3 1.63e-35 124 45 3 157 3 smpB SsrA-binding protein Maricaulis maris (strain MCS10)
Q3B0J2 1.94e-35 124 44 0 135 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9902)
B9KMM4 2.27e-35 123 46 3 152 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZG8 2.27e-35 123 46 3 152 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PMS9 2.27e-35 123 46 3 152 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q24MW8 2.35e-35 123 40 1 151 3 smpB SsrA-binding protein Desulfitobacterium hafniense (strain Y51)
B8FXV6 2.35e-35 123 40 1 151 3 smpB SsrA-binding protein Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C4L5G5 2.48e-35 123 40 1 149 3 smpB SsrA-binding protein Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A9NF97 2.63e-35 123 44 1 143 3 smpB SsrA-binding protein Acholeplasma laidlawii (strain PG-8A)
Q3A3J2 3.09e-35 122 44 1 147 3 smpB SsrA-binding protein Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A9KPF1 3.14e-35 123 41 1 141 3 smpB SsrA-binding protein Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A1A0L5 3.37e-35 123 45 2 152 3 smpB SsrA-binding protein Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q7V911 3.51e-35 123 46 0 130 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9313)
A7IM13 4.11e-35 122 43 3 160 3 smpB SsrA-binding protein Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A4VW67 4.48e-35 122 44 1 144 3 smpB SsrA-binding protein Streptococcus suis (strain 05ZYH33)
A4W2H3 4.48e-35 122 44 1 144 3 smpB SsrA-binding protein Streptococcus suis (strain 98HAH33)
A5V3L8 5.12e-35 122 41 2 148 3 smpB SsrA-binding protein Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
P43659 6.17e-35 122 42 2 149 3 smpB SsrA-binding protein Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
Q03LI8 8.1e-35 122 43 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M570 8.1e-35 122 43 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0N4 8.1e-35 122 43 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain CNRZ 1066)
P66859 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella suis biovar 1 (strain 1330)
B0CKX3 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella suis (strain ATCC 23445 / NCTC 10510)
P66858 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHY9 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella melitensis biotype 2 (strain ATCC 23457)
A9MA22 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57E95 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella abortus biovar 1 (strain 9-941)
Q2YMY0 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella abortus (strain 2308)
B2SAC5 8.15e-35 122 40 3 160 3 smpB SsrA-binding protein Brucella abortus (strain S19)
Q214K5 9.63e-35 122 41 2 148 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisB18)
Q03SK9 9.84e-35 122 42 1 157 3 smpB SsrA-binding protein Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A4J8T4 1.12e-34 122 41 2 157 3 smpB SsrA-binding protein Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A6Q776 1.23e-34 121 44 1 145 3 smpB SsrA-binding protein Sulfurovum sp. (strain NBC37-1)
A7HGZ0 1.26e-34 122 47 1 140 3 smpB SsrA-binding protein Anaeromyxobacter sp. (strain Fw109-5)
A9G109 1.4e-34 121 43 3 161 3 smpB SsrA-binding protein Sorangium cellulosum (strain So ce56)
A6X299 1.42e-34 121 40 3 160 3 smpB SsrA-binding protein Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A7HX37 1.42e-34 121 42 3 158 3 smpB SsrA-binding protein Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A2C637 1.57e-34 121 45 0 130 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9303)
C0QUM8 1.78e-34 120 44 1 139 3 smpB SsrA-binding protein Persephonella marina (strain DSM 14350 / EX-H1)
A3PFA6 1.84e-34 121 45 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9301)
P0DF81 1.88e-34 121 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF80 1.88e-34 121 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B5XK94 2.03e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M49 (strain NZ131)
Q48UT9 2.03e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JI42 2.03e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XDD6 2.03e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9A126 2.03e-34 120 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M1
A2BTJ8 2.05e-34 121 45 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain AS9601)
Q318C5 2.43e-34 121 43 0 143 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9312)
A5EKM6 2.85e-34 120 40 2 153 3 smpB SsrA-binding protein Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B1I1B6 3.06e-34 120 45 1 141 3 smpB SsrA-binding protein Desulforudis audaxviator (strain MP104C)
Q3AND9 3.24e-34 120 44 0 137 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9605)
B4U434 3.42e-34 120 43 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q16BP2 3.71e-34 120 42 2 152 3 smpB SsrA-binding protein Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A4YWD7 4.08e-34 120 40 2 154 3 smpB SsrA-binding protein Bradyrhizobium sp. (strain ORS 278)
Q28WG4 4.53e-34 120 40 2 157 3 smpB SsrA-binding protein Jannaschia sp. (strain CCS1)
Q7U9W8 4.73e-34 120 43 0 135 3 smpB SsrA-binding protein Parasynechococcus marenigrum (strain WH8102)
P66865 4.79e-34 120 43 1 145 3 smpB SsrA-binding protein Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66864 4.79e-34 120 43 1 145 3 smpB SsrA-binding protein Streptococcus agalactiae serotype III (strain NEM316)
Q3K035 4.79e-34 120 43 1 145 3 smpB SsrA-binding protein Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C0MCH3 5.17e-34 120 42 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. zooepidemicus (strain H70)
Q7V9Q3 6.1e-34 120 43 1 144 3 smpB SsrA-binding protein Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q2JV45 6.89e-34 119 48 0 148 3 smpB SsrA-binding protein Synechococcus sp. (strain JA-3-3Ab)
Q985B9 7.28e-34 119 38 2 160 3 smpB SsrA-binding protein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6NIL8 7.81e-34 119 45 1 135 3 smpB SsrA-binding protein Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q1GDQ2 7.98e-34 119 42 3 160 3 smpB SsrA-binding protein Ruegeria sp. (strain TM1040)
Q1J7Y3 9.2e-34 119 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M4 (strain MGAS10750)
C0MAA1 9.3e-34 119 41 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. equi (strain 4047)
Q1JMZ7 1.05e-33 119 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD22 1.05e-33 119 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q2JM08 1.4e-33 119 47 0 148 3 smpB SsrA-binding protein Synechococcus sp. (strain JA-2-3B'a(2-13))
A0LVP0 1.41e-33 119 44 1 146 3 smpB SsrA-binding protein Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A2RFZ7 1.62e-33 118 43 1 144 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M5 (strain Manfredo)
Q184Z6 2.17e-33 118 42 1 142 3 smpB SsrA-binding protein Clostridioides difficile (strain 630)
A5CYM8 2.19e-33 118 41 1 148 3 smpB SsrA-binding protein Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q1RIJ4 2.48e-33 118 42 3 147 3 smpB SsrA-binding protein Rickettsia bellii (strain RML369-C)
B9DTZ7 2.7e-33 118 41 1 143 3 smpB SsrA-binding protein Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q7VJX1 2.7e-33 118 41 2 150 3 smpB SsrA-binding protein Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A5FZS6 2.8e-33 118 43 2 144 3 smpB SsrA-binding protein Acidiphilium cryptum (strain JF-5)
A0LDB8 2.9e-33 117 43 1 143 3 smpB SsrA-binding protein Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A8GWS0 3.09e-33 117 42 3 147 3 smpB SsrA-binding protein Rickettsia bellii (strain OSU 85-389)
Q2KAF1 3.29e-33 118 40 2 160 3 smpB SsrA-binding protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PUN0 3.29e-33 118 40 2 160 3 smpB SsrA-binding protein Rhizobium etli (strain CIAT 652)
A9BD59 3.41e-33 118 42 0 137 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9211)
Q6G467 3.73e-33 117 40 3 160 3 smpB SsrA-binding protein Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A5VPI6 4.11e-33 117 39 3 160 3 smpB SsrA-binding protein Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q2RLS9 4.16e-33 117 42 2 141 3 smpB SsrA-binding protein Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q04E23 4.49e-33 117 40 2 157 3 smpB SsrA-binding protein Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q5LLW5 5e-33 117 42 2 154 3 smpB SsrA-binding protein Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3CPW2 5.36e-33 117 45 2 146 3 smpB SsrA-binding protein Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q3AFC2 6.59e-33 117 42 2 147 3 smpB SsrA-binding protein Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q4JX42 6.59e-33 118 43 2 148 3 smpB SsrA-binding protein Corynebacterium jeikeium (strain K411)
A9IRK6 7.08e-33 117 40 3 160 3 smpB SsrA-binding protein Bartonella tribocorum (strain CIP 105476 / IBS 506)
A0LGB7 7.29e-33 117 44 4 159 3 smpB SsrA-binding protein Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B7GUE4 7.47e-33 117 46 2 150 3 smpB SsrA-binding protein Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G540 7.47e-33 117 46 2 150 3 smpB SsrA-binding protein Bifidobacterium longum (strain NCC 2705)
B3DTB5 7.47e-33 117 46 2 150 3 smpB SsrA-binding protein Bifidobacterium longum (strain DJO10A)
A8G7C2 7.6e-33 117 44 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9215)
Q7M9J0 7.61e-33 117 44 1 134 3 smpB SsrA-binding protein Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8RB39 7.8e-33 117 44 1 135 3 smpB SsrA-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0BSV8 9.02e-33 117 42 2 146 3 smpB SsrA-binding protein Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q9RH74 1.05e-32 116 39 2 148 3 smpB SsrA-binding protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6G090 1.07e-32 116 38 2 157 3 smpB SsrA-binding protein Bartonella quintana (strain Toulouse)
Q6AEL7 1.09e-32 116 42 3 155 3 smpB SsrA-binding protein Leifsonia xyli subsp. xyli (strain CTCB07)
C0R392 1.13e-32 116 43 3 148 3 smpB SsrA-binding protein Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73H09 1.13e-32 116 43 3 148 3 smpB SsrA-binding protein Wolbachia pipientis wMel
Q0IDW2 1.24e-32 116 43 0 132 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9311)
Q0BYG5 1.34e-32 116 43 2 144 3 smpB SsrA-binding protein Hyphomonas neptunium (strain ATCC 15444)
Q8FRE7 1.57e-32 116 44 2 145 3 smpB SsrA-binding protein Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1SG51 1.57e-32 116 48 2 141 3 smpB SsrA-binding protein Nocardioides sp. (strain ATCC BAA-499 / JS614)
A6WEK3 1.82e-32 116 43 1 146 3 smpB SsrA-binding protein Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q8DSZ5 1.88e-32 115 43 1 150 3 smpB SsrA-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B9JC66 2.13e-32 115 41 2 157 3 smpB SsrA-binding protein Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A5GI45 2.47e-32 115 41 0 132 3 smpB SsrA-binding protein Synechococcus sp. (strain WH7803)
A9BF44 2.81e-32 115 45 3 139 3 smpB SsrA-binding protein Petrotoga mobilis (strain DSM 10674 / SJ95)
Q3Z6E3 3.06e-32 115 38 1 152 3 smpB SsrA-binding protein Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q07M67 3.28e-32 115 39 2 148 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisA53)
Q03VG0 3.29e-32 115 39 1 144 3 smpB SsrA-binding protein Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q6F1Q6 3.32e-32 115 39 0 148 3 smpB SsrA-binding protein Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
P9WGD3 3.46e-32 115 41 2 156 1 smpB SsrA-binding protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGD2 3.46e-32 115 41 2 156 3 smpB SsrA-binding protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18240
Feature type CDS
Gene smpB
Product SsrA-binding protein SmpB
Location 31642 - 32124 (strand: 1)
Length 483 (nucleotides) / 160 (amino acids)
In genomic island -

Contig

Accession ZDB_704
Length 35007 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2371
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01668 SmpB protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0691 Posttranslational modification, protein turnover, chaperones (O) O tmRNA-binding protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03664 SsrA-binding protein - -

Protein Sequence

MTKKKVHKPGSATIALNKRARHDYFIEEEIEAGLALQGWEVKSLRAGKANLGDSYVILRDGEAFLFGANFTPLSVASSHVVCDPTRTRKLLLNQRELDSLYGKINRDGHTVVALSLYWKNAWCKVKIGIAKGKKEHDKRDDIREREWKLDKARIMKHAGR

Flanking regions ( +/- flanking 50bp)

ATAAATAAGCAATTTATTTCGGGTGTGCATAACGTATAATAGTGGTCATTATGACAAAGAAAAAAGTTCACAAACCAGGCTCTGCCACCATCGCGCTGAACAAACGCGCCCGCCACGACTACTTTATCGAAGAAGAGATAGAGGCAGGTCTGGCGCTGCAGGGCTGGGAAGTCAAATCATTACGCGCAGGTAAAGCTAACCTGGGGGACAGTTACGTCATCCTCCGTGACGGCGAAGCTTTCCTGTTTGGTGCCAACTTCACACCGCTCAGCGTGGCCTCATCCCACGTTGTCTGCGACCCGACCCGGACACGCAAACTGCTGCTCAACCAGCGTGAACTGGACAGCCTGTACGGCAAAATCAACCGTGACGGGCACACCGTGGTTGCACTGTCGCTGTACTGGAAAAACGCCTGGTGCAAAGTCAAAATCGGCATTGCCAAAGGTAAGAAAGAACACGACAAACGCGATGACATCCGCGAACGTGAGTGGAAATTAGACAAAGCAAGAATTATGAAGCACGCAGGGCGTTAAGTACTGGTATTCCGTACTGATTTTCTGATATACTGCGTTTCACAACTTGG