Homologs in group_2371

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18350 FBDBKF_18350 84.4 Morganella morganii S1 smpB SsrA-binding protein SmpB
EHELCC_18385 EHELCC_18385 84.4 Morganella morganii S2 smpB SsrA-binding protein SmpB
NLDBIP_18310 NLDBIP_18310 84.4 Morganella morganii S4 smpB SsrA-binding protein SmpB
LHKJJB_18505 LHKJJB_18505 84.4 Morganella morganii S3 smpB SsrA-binding protein SmpB
HKOGLL_18240 HKOGLL_18240 84.4 Morganella morganii S5 smpB SsrA-binding protein SmpB
F4V73_RS01880 F4V73_RS01880 81.9 Morganella psychrotolerans smpB SsrA-binding protein SmpB

Distribution of the homologs in the orthogroup group_2371

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2371

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F065 4.03e-117 330 100 0 160 3 smpB SsrA-binding protein Proteus mirabilis (strain HI4320)
A7MHX6 4.14e-103 295 86 0 160 3 smpB SsrA-binding protein Cronobacter sakazakii (strain ATCC BAA-894)
Q3YYQ2 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Shigella sonnei (strain Ss046)
P0A835 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Shigella flexneri
Q0T186 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Shigella flexneri serotype 5b (strain 8401)
Q32CW9 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Shigella dysenteriae serotype 1 (strain Sd197)
Q31XC6 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Shigella boydii serotype 4 (strain Sb227)
B2TYP2 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUV4 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8A4 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain UTI89 / UPEC)
B1LPC7 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain SMS-3-5 / SECEC)
B6I641 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain SE11)
B7N6K5 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A832 3.48e-102 292 85 0 160 1 smpB SsrA-binding protein Escherichia coli (strain K12)
B1IVL4 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A833 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AEE9 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O1:K1 / APEC
A8A3C6 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O9:H4 (strain HS)
B1XBU0 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain K12 / DH10B)
C4ZYN7 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain K12 / MC4100 / BW2952)
B7M989 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O8 (strain IAI1)
B7MYQ8 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O81 (strain ED1a)
B7NSB8 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z237 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A834 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O157:H7
B7LDK8 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli (strain 55989 / EAEC)
B7MIV7 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH68 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQ60 3.48e-102 292 85 0 160 3 smpB SsrA-binding protein Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ANF2 4.01e-102 292 85 0 160 3 smpB SsrA-binding protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q0TEM0 9.03e-102 291 84 0 160 3 smpB SsrA-binding protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7N1U1 1.2e-101 291 84 0 160 3 smpB SsrA-binding protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P0A2G1 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2G2 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella typhi
B4TS67 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella schwarzengrund (strain CVM19633)
B5BEA6 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi A (strain AKU_12601)
C0PW29 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi C (strain RKS4594)
A9MZ63 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFG2 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2C5 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella newport (strain SL254)
B4TE63 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella heidelberg (strain SL476)
B5RD96 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUH5 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella enteritidis PT4 (strain P125109)
Q57L18 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella choleraesuis (strain SC-B67)
B5F2A0 2.15e-100 288 84 0 160 3 smpB SsrA-binding protein Salmonella agona (strain SL483)
A1JKI0 5.9e-100 287 85 0 160 3 smpB SsrA-binding protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BAL3 1.22e-99 286 82 0 160 3 smpB SsrA-binding protein Edwardsiella ictaluri (strain 93-146)
A9MGS5 1.52e-99 286 83 0 160 3 smpB SsrA-binding protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TCM7 2.23e-99 285 84 0 160 3 smpB SsrA-binding protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVJ3 2.23e-99 285 84 0 160 3 smpB SsrA-binding protein Klebsiella pneumoniae (strain 342)
B2VEC0 2.43e-99 285 81 0 160 3 smpB SsrA-binding protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6D970 3.41e-99 285 83 0 160 3 smpB SsrA-binding protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q66DB4 1.33e-98 283 82 0 160 3 smpB SsrA-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNV2 1.33e-98 283 82 0 160 3 smpB SsrA-binding protein Yersinia pestis (strain Pestoides F)
Q1CFK6 1.33e-98 283 82 0 160 3 smpB SsrA-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH14 1.33e-98 283 82 0 160 3 smpB SsrA-binding protein Yersinia pestis
Q1CAH5 1.33e-98 283 82 0 160 3 smpB SsrA-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKS8 1.33e-98 283 82 0 160 3 smpB SsrA-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WDI4 3.81e-98 282 83 0 160 3 smpB SsrA-binding protein Enterobacter sp. (strain 638)
A8GI46 6.32e-98 282 83 0 160 3 smpB SsrA-binding protein Serratia proteamaculans (strain 568)
Q6D8Y5 2.49e-97 280 82 0 160 3 smpB SsrA-binding protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q65SE8 3.03e-97 280 83 1 160 3 smpB SsrA-binding protein Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2NRZ6 3.54e-95 275 80 0 160 3 smpB SsrA-binding protein Sodalis glossinidius (strain morsitans)
C4K4E2 1.54e-92 268 78 0 160 3 smpB SsrA-binding protein Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A6VMQ1 1.03e-91 266 80 0 157 3 smpB SsrA-binding protein Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44967 2.17e-91 265 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UD90 2.17e-91 265 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain PittEE)
Q4QLS9 2.17e-91 265 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain 86-028NP)
A5UIC0 2.79e-91 265 78 1 160 3 smpB SsrA-binding protein Haemophilus influenzae (strain PittGG)
P57827 7.57e-91 264 79 1 158 3 smpB SsrA-binding protein Pasteurella multocida (strain Pm70)
B3H1K6 3.79e-90 262 79 0 156 3 smpB SsrA-binding protein Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0M7 3.79e-90 262 79 0 156 3 smpB SsrA-binding protein Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F4Q7 5.87e-90 261 79 0 156 3 smpB SsrA-binding protein Glaesserella parasuis serovar 5 (strain SH0165)
B0USL1 1.24e-88 258 77 1 160 3 smpB SsrA-binding protein Histophilus somni (strain 2336)
Q0I279 1.24e-88 258 77 1 160 3 smpB SsrA-binding protein Histophilus somni (strain 129Pt)
Q7VM64 5.04e-88 257 79 0 156 3 smpB SsrA-binding protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4L8Z2 1.92e-80 238 68 0 160 3 smpB SsrA-binding protein Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q87RY2 7.06e-80 236 71 1 161 3 smpB SsrA-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KI80 1.21e-78 233 70 1 161 3 smpB SsrA-binding protein Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MWX4 4.96e-78 231 68 1 161 3 smpB SsrA-binding protein Vibrio campbellii (strain ATCC BAA-1116)
C3LT98 5.12e-77 229 68 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain M66-2)
P52116 5.12e-77 229 68 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F375 5.12e-77 229 68 1 161 3 smpB SsrA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SPV7 7.34e-76 226 67 1 161 3 smpB SsrA-binding protein Aeromonas salmonicida (strain A449)
Q7MN99 3.39e-73 219 72 1 159 3 smpB SsrA-binding protein Vibrio vulnificus (strain YJ016)
Q8DF53 3.39e-73 219 72 1 159 3 smpB SsrA-binding protein Vibrio vulnificus (strain CMCP6)
Q5QW47 1.41e-72 218 63 1 160 3 smpB SsrA-binding protein Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B5FA19 2.87e-72 217 63 1 161 3 smpB SsrA-binding protein Aliivibrio fischeri (strain MJ11)
B6EKA9 3.46e-72 217 63 1 161 3 smpB SsrA-binding protein Aliivibrio salmonicida (strain LFI1238)
Q5E399 4.5e-72 216 63 1 161 3 smpB SsrA-binding protein Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1SV84 3.48e-70 212 62 1 161 3 smpB SsrA-binding protein Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A3QCE0 6.78e-70 211 66 1 150 3 smpB SsrA-binding protein Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8H222 1.01e-68 208 62 2 161 3 smpB SsrA-binding protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLG2 1.01e-68 208 62 2 161 3 smpB SsrA-binding protein Shewanella halifaxensis (strain HAW-EB4)
Q12PV1 2.57e-68 207 64 2 159 3 smpB SsrA-binding protein Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8FT45 3.23e-68 207 65 1 146 3 smpB SsrA-binding protein Shewanella sediminis (strain HAW-EB3)
B1KKG8 1.34e-67 205 65 1 146 3 smpB SsrA-binding protein Shewanella woodyi (strain ATCC 51908 / MS32)
Q085W8 1.48e-67 205 63 2 157 3 smpB SsrA-binding protein Shewanella frigidimarina (strain NCIMB 400)
Q3IE36 2.51e-67 204 59 0 157 3 smpB SsrA-binding protein Pseudoalteromonas translucida (strain TAC 125)
Q6LUB4 5.7e-67 203 63 0 148 3 smpB SsrA-binding protein Photobacterium profundum (strain SS9)
A1U622 2.07e-66 202 60 0 159 3 smpB SsrA-binding protein Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q15V28 3.83e-66 201 58 0 155 3 smpB SsrA-binding protein Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q0HSR7 6.83e-66 201 59 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain MR-7)
Q8EGW8 6.83e-66 201 59 1 157 3 smpB SsrA-binding protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B4RXY7 7.98e-66 201 58 0 158 3 smpB SsrA-binding protein Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q47XH8 1.42e-65 200 61 0 147 3 smpB SsrA-binding protein Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0HGH0 1.66e-65 200 58 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain MR-4)
A0KZF9 1.66e-65 200 58 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain ANA-3)
Q604C6 1.85e-65 199 59 1 156 3 smpB SsrA-binding protein Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1S886 8.96e-65 198 61 2 159 3 smpB SsrA-binding protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5WSX5 2.34e-63 194 64 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Lens)
Q5X148 2.34e-63 194 64 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Paris)
Q5ZRP1 3.4e-63 194 64 2 156 3 smpB SsrA-binding protein Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5II10 3.4e-63 194 64 2 156 3 smpB SsrA-binding protein Legionella pneumophila (strain Corby)
Q6F8J9 3.53e-62 191 60 0 148 3 smpB SsrA-binding protein Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A4VPR2 2.91e-61 189 58 1 160 3 smpB SsrA-binding protein Stutzerimonas stutzeri (strain A1501)
Q0VSU5 3.59e-61 189 56 1 154 3 smpB SsrA-binding protein Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1IF66 4.05e-61 189 57 1 157 3 smpB SsrA-binding protein Pseudomonas entomophila (strain L48)
Q4FUW4 8.25e-61 188 59 1 153 3 smpB SsrA-binding protein Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q88DT6 3.13e-60 186 57 1 157 3 smpB SsrA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9A9 3.13e-60 186 57 1 157 3 smpB SsrA-binding protein Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1QDW1 4.12e-60 186 59 1 153 3 smpB SsrA-binding protein Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q8KTI4 7.03e-60 186 61 1 146 3 smpB SsrA-binding protein Azotobacter vinelandii
C1DFN0 7.03e-60 186 61 1 146 3 smpB SsrA-binding protein Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0KIT1 9.24e-60 185 57 1 157 3 smpB SsrA-binding protein Pseudomonas putida (strain GB-1)
B0V8G6 1.3e-59 185 58 1 151 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AYE)
A3M2Y4 1.3e-59 185 58 1 151 3 smpB SsrA-binding protein Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HUN4 1.3e-59 185 58 1 151 3 smpB SsrA-binding protein Acinetobacter baumannii (strain ACICU)
B7I7Q2 1.3e-59 185 58 1 151 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AB0057)
B7GYP8 1.3e-59 185 58 1 151 3 smpB SsrA-binding protein Acinetobacter baumannii (strain AB307-0294)
A1RLZ8 1.4e-59 185 59 1 157 3 smpB SsrA-binding protein Shewanella sp. (strain W3-18-1)
A4Y4S4 1.4e-59 185 59 1 157 3 smpB SsrA-binding protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C5BQH7 1.65e-59 184 57 1 160 3 smpB SsrA-binding protein Teredinibacter turnerae (strain ATCC 39867 / T7901)
A4XYG4 2.01e-59 184 56 1 160 3 smpB SsrA-binding protein Pseudomonas mendocina (strain ymp)
Q9HV40 2.59e-59 184 56 1 158 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FQ4 2.59e-59 184 56 1 158 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1I0 2.59e-59 184 56 1 158 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain LESB58)
A6VCM5 2.59e-59 184 56 1 158 3 smpB SsrA-binding protein Pseudomonas aeruginosa (strain PA7)
B1J247 5.68e-59 183 56 1 157 3 smpB SsrA-binding protein Pseudomonas putida (strain W619)
B4SS56 5.71e-59 183 56 0 148 3 smpB SsrA-binding protein Stenotrophomonas maltophilia (strain R551-3)
A9KTG8 8.78e-59 183 59 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS195)
A6WKV9 8.78e-59 183 59 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS185)
A3D262 8.78e-59 183 59 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EAZ5 8.78e-59 183 59 1 157 3 smpB SsrA-binding protein Shewanella baltica (strain OS223)
A5WH04 1.01e-58 182 58 1 154 3 smpB SsrA-binding protein Psychrobacter sp. (strain PRwf-1)
B2FMX5 1.08e-58 183 56 0 148 3 smpB SsrA-binding protein Stenotrophomonas maltophilia (strain K279a)
Q0A7D4 6.58e-58 181 55 0 153 3 smpB SsrA-binding protein Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1QSW3 2.48e-57 179 55 1 156 3 smpB SsrA-binding protein Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9PAZ7 2.56e-57 179 56 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain 9a5c)
B0U3K6 4.24e-57 179 56 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain M12)
Q2SMN6 9.91e-57 177 56 1 157 3 smpB SsrA-binding protein Hahella chejuensis (strain KCTC 2396)
Q8PMB9 1.32e-56 177 55 0 151 3 smpB SsrA-binding protein Xanthomonas axonopodis pv. citri (strain 306)
Q4KIH9 1.49e-56 177 57 1 146 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q31FR9 1.77e-56 177 57 1 154 3 smpB SsrA-binding protein Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3BVC6 2.33e-56 177 55 0 151 3 smpB SsrA-binding protein Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q87BS0 2.57e-56 177 56 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6G4 2.57e-56 177 56 0 148 3 smpB SsrA-binding protein Xylella fastidiosa (strain M23)
A1WX40 2.94e-56 176 54 0 153 3 smpB SsrA-binding protein Halorhodospira halophila (strain DSM 244 / SL1)
A9KGA3 4.11e-56 176 50 0 157 3 smpB SsrA-binding protein Coxiella burnetii (strain Dugway 5J108-111)
B6IZH7 4.11e-56 176 50 0 157 3 smpB SsrA-binding protein Coxiella burnetii (strain CbuG_Q212)
Q8PAL7 4.12e-56 176 54 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVV0 4.12e-56 176 54 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain B100)
Q4UT03 4.12e-56 176 54 0 151 3 smpB SsrA-binding protein Xanthomonas campestris pv. campestris (strain 8004)
Q83C29 1.32e-55 174 50 0 157 3 smpB SsrA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q87WN1 1.38e-55 174 58 1 146 3 smpB SsrA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5H194 1.63e-55 175 54 0 151 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQV2 1.63e-55 175 54 0 151 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P468 1.84e-55 174 54 0 151 3 smpB SsrA-binding protein Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B6J7W1 2.44e-55 174 50 0 157 3 smpB SsrA-binding protein Coxiella burnetii (strain CbuK_Q154)
A9N8I5 5.25e-55 173 50 0 157 3 smpB SsrA-binding protein Coxiella burnetii (strain RSA 331 / Henzerling II)
Q4ZNN9 9.16e-55 172 58 1 146 3 smpB SsrA-binding protein Pseudomonas syringae pv. syringae (strain B728a)
A1AW41 9.2e-55 172 56 0 147 3 smpB SsrA-binding protein Ruthia magnifica subsp. Calyptogena magnifica
A5CX31 1.4e-54 172 55 0 156 3 smpB SsrA-binding protein Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A6W2E0 2.22e-54 171 52 0 157 3 smpB SsrA-binding protein Marinomonas sp. (strain MWYL1)
Q1LSR7 3.11e-54 171 59 0 149 3 smpB SsrA-binding protein Baumannia cicadellinicola subsp. Homalodisca coagulata
Q21H28 3.15e-54 171 53 0 151 3 smpB SsrA-binding protein Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3KIA8 1.32e-53 169 53 1 160 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain Pf0-1)
C3K282 1.68e-53 169 53 1 157 3 smpB SsrA-binding protein Pseudomonas fluorescens (strain SBW25)
Q48E54 1.68e-53 169 58 0 139 3 smpB SsrA-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B3PF48 2.75e-53 169 52 0 157 3 smpB SsrA-binding protein Cellvibrio japonicus (strain Ueda107)
Q3JBU6 1.27e-52 168 52 0 144 3 smpB SsrA-binding protein Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5EXZ5 2.26e-52 166 49 0 147 3 smpB SsrA-binding protein Dichelobacter nodosus (strain VCS1703A)
B0TY34 3.29e-52 166 53 0 154 3 smpB SsrA-binding protein Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q8XZH1 4.72e-52 165 53 0 145 3 smpB SsrA-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2Y9R5 5.28e-52 165 51 0 144 3 smpB SsrA-binding protein Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3R297 7.31e-52 165 54 0 146 3 smpB SsrA-binding protein Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KA36 1.55e-51 164 54 0 145 3 smpB SsrA-binding protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A4IYL4 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFP4 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BMI2 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain OSU18)
B2SGA3 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A446 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain LVS)
A7NBC7 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14H46 2.06e-51 164 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. tularensis (strain FSC 198)
Q21VE0 2.46e-51 164 51 1 154 3 smpB SsrA-binding protein Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A0Q735 3.48e-51 163 52 0 152 3 smpB SsrA-binding protein Francisella tularensis subsp. novicida (strain U112)
Q1LND7 3.6e-51 163 53 0 146 3 smpB SsrA-binding protein Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q470F7 6.63e-51 162 52 0 148 3 smpB SsrA-binding protein Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7NSG2 7.07e-51 162 52 0 145 3 smpB SsrA-binding protein Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B2UBC4 8.74e-51 162 52 0 145 3 smpB SsrA-binding protein Ralstonia pickettii (strain 12J)
Q47DK3 8.92e-51 162 51 0 148 3 smpB SsrA-binding protein Dechloromonas aromatica (strain RCB)
Q3SI24 1.06e-50 162 49 0 147 3 smpB SsrA-binding protein Thiobacillus denitrificans (strain ATCC 25259)
A1W8Y5 2.57e-50 161 51 0 150 3 smpB SsrA-binding protein Acidovorax sp. (strain JS42)
B9MGQ0 2.57e-50 161 51 0 150 3 smpB SsrA-binding protein Acidovorax ebreus (strain TPSY)
Q2L136 3.59e-50 160 49 0 148 3 smpB SsrA-binding protein Bordetella avium (strain 197N)
Q5NYE0 3.82e-50 160 51 0 144 3 smpB SsrA-binding protein Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7VYA8 6.32e-50 160 48 0 148 3 smpB SsrA-binding protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WJ73 6.32e-50 160 48 0 148 3 smpB SsrA-binding protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WA41 6.39e-50 160 48 0 148 3 smpB SsrA-binding protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A1WPQ3 8.64e-50 160 49 1 156 3 smpB SsrA-binding protein Verminephrobacter eiseniae (strain EF01-2)
Q82X65 9.22e-50 159 47 0 144 3 smpB SsrA-binding protein Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1K5T8 1.75e-49 159 51 0 144 3 smpB SsrA-binding protein Azoarcus sp. (strain BH72)
Q0AIG7 3.62e-49 158 48 0 144 3 smpB SsrA-binding protein Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1TSJ4 8.56e-49 157 50 1 154 3 smpB SsrA-binding protein Paracidovorax citrulli (strain AAC00-1)
Q12AT7 3.88e-48 155 50 0 147 3 smpB SsrA-binding protein Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2SWX6 9.41e-48 154 49 0 147 3 smpB SsrA-binding protein Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q13XD6 1.18e-47 154 47 0 146 3 smpB SsrA-binding protein Paraburkholderia xenovorans (strain LB400)
A4SYS6 1.23e-47 154 49 0 145 3 smpB SsrA-binding protein Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q63T34 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain K96243)
A3NAS3 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 668)
Q3JR53 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 1710b)
A3NWK5 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia pseudomallei (strain 1106a)
A1V545 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia mallei (strain SAVP1)
Q62JE7 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia mallei (strain ATCC 23344)
A2SB97 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia mallei (strain NCTC 10229)
A3MKR8 1.77e-47 154 49 0 147 3 smpB SsrA-binding protein Burkholderia mallei (strain NCTC 10247)
B8D7F1 5.37e-47 153 48 0 143 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57342 5.37e-47 153 48 0 143 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D947 5.37e-47 153 48 0 143 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q1H274 5.7e-47 152 47 0 144 3 smpB SsrA-binding protein Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A4JF55 2.09e-46 151 49 0 144 3 smpB SsrA-binding protein Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BHG2 2.09e-46 151 49 0 144 3 smpB SsrA-binding protein Burkholderia orbicola (strain AU 1054)
A0K8C3 2.09e-46 151 49 0 144 3 smpB SsrA-binding protein Burkholderia cenocepacia (strain HI2424)
Q0BE35 2.9e-46 150 49 0 144 3 smpB SsrA-binding protein Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39F63 3.9e-46 150 49 0 144 3 smpB SsrA-binding protein Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5F816 1.05e-45 149 49 0 145 3 smpB SsrA-binding protein Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B1Y225 1.52e-45 149 45 0 145 3 smpB SsrA-binding protein Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A2SG89 2.43e-45 149 47 0 144 3 smpB SsrA-binding protein Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1KUW3 6.73e-45 147 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0Y8 6.73e-45 147 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Y7 6.73e-45 147 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M0W1 6.73e-45 147 48 0 145 3 smpB SsrA-binding protein Neisseria meningitidis serogroup C (strain 053442)
B0JTG1 1.05e-42 142 48 0 143 3 smpB SsrA-binding protein Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B1HWE9 1.75e-42 141 45 1 153 3 smpB SsrA-binding protein Lysinibacillus sphaericus (strain C3-41)
Q2RT81 1.94e-42 141 49 1 145 3 smpB SsrA-binding protein Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2N9K0 2.24e-42 141 49 2 146 3 smpB SsrA-binding protein Erythrobacter litoralis (strain HTCC2594)
A5UPS2 3.52e-42 140 45 0 148 3 smpB SsrA-binding protein Roseiflexus sp. (strain RS-1)
B9EAH5 4.94e-42 140 47 1 144 3 smpB SsrA-binding protein Macrococcus caseolyticus (strain JCSC5402)
Q8NXL2 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MW2)
A8Z1A9 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain USA300 / TCH1516)
Q6GB49 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MSSA476)
Q6GIK9 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain MRSA252)
A6QF90 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Newman)
Q5HHN6 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain COL)
Q2YWK9 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G023 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIL2 7.06e-42 140 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain USA300)
A5G3A5 8.38e-42 139 46 1 147 3 smpB SsrA-binding protein Geotalea uraniireducens (strain Rf4)
P66863 8.78e-42 139 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain N315)
P66862 8.78e-42 139 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQY5 8.78e-42 139 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain JH9)
A6TZR0 8.78e-42 139 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain JH1)
A7WZT9 8.78e-42 139 49 3 156 3 smpB SsrA-binding protein Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1ANL4 1.12e-41 139 45 1 151 3 smpB SsrA-binding protein Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B2TPV9 1.92e-41 139 43 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Eklund 17B / Type B)
B2UY12 1.92e-41 139 43 2 160 3 smpB SsrA-binding protein Clostridium botulinum (strain Alaska E43 / Type E3)
Q39V47 2.71e-41 138 47 2 151 3 smpB SsrA-binding protein Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9K721 5.31e-41 137 45 1 148 3 smpB SsrA-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8K9R5 6.22e-41 137 45 1 148 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B9DJK4 7.48e-41 137 45 2 157 3 smpB SsrA-binding protein Staphylococcus carnosus (strain TM300)
Q5WDM4 9.82e-41 137 43 1 148 3 smpB SsrA-binding protein Shouchella clausii (strain KSM-K16)
Q4FLS2 1.09e-40 137 46 1 149 3 smpB SsrA-binding protein Pelagibacter ubique (strain HTCC1062)
Q8YM70 1.13e-40 137 45 0 145 3 smpB SsrA-binding protein Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B8H482 1.42e-40 136 48 2 147 1 smpB SsrA-binding protein Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8Z9 1.42e-40 136 48 2 147 3 smpB SsrA-binding protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5N2N2 1.86e-40 136 46 1 150 3 smpB SsrA-binding protein Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E6A8 1.86e-40 136 46 1 150 3 smpB SsrA-binding protein Clostridium kluyveri (strain NBRC 12016)
Q89AM9 2.14e-40 136 39 1 156 3 smpB SsrA-binding protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3MAP3 2.21e-40 136 45 0 145 3 smpB SsrA-binding protein Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q49W09 3.27e-40 135 48 3 156 3 smpB SsrA-binding protein Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CPX9 3.29e-40 135 46 2 156 3 smpB SsrA-binding protein Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQU5 3.29e-40 135 46 2 156 3 smpB SsrA-binding protein Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2W477 3.36e-40 135 48 3 150 3 smpB SsrA-binding protein Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B7KF17 3.48e-40 135 46 0 143 3 smpB SsrA-binding protein Gloeothece citriformis (strain PCC 7424)
Q0APB3 6.54e-40 135 49 3 158 3 smpB SsrA-binding protein Maricaulis maris (strain MCS10)
B1KTK2 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Loch Maree / Type A3)
A7G9Y7 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IDC3 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Okra / Type B1)
C1FQX0 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Kyoto / Type A2)
A5HYC7 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KZ53 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain 657 / Type Ba4)
A7FQP4 7.78e-40 134 45 1 155 3 smpB SsrA-binding protein Clostridium botulinum (strain ATCC 19397 / Type A)
Q74CG4 8.56e-40 134 45 2 151 3 smpB SsrA-binding protein Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A4ISN8 8.7e-40 134 46 1 144 3 smpB SsrA-binding protein Geobacillus thermodenitrificans (strain NG80-2)
Q4L4L2 9.67e-40 134 44 2 157 3 smpB SsrA-binding protein Staphylococcus haemolyticus (strain JCSC1435)
P74355 1.41e-39 134 45 0 144 3 smpB SsrA-binding protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B7GLX3 1.62e-39 134 46 1 143 3 smpB SsrA-binding protein Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q5KVF8 1.87e-39 134 46 1 144 3 smpB SsrA-binding protein Geobacillus kaustophilus (strain HTA426)
B2J722 2.42e-39 133 44 0 148 3 smpB SsrA-binding protein Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A7NS28 4.27e-39 133 43 0 148 3 smpB SsrA-binding protein Roseiflexus castenholzii (strain DSM 13941 / HLO8)
C5D7L7 4.66e-39 132 46 1 143 3 smpB SsrA-binding protein Geobacillus sp. (strain WCH70)
B0T1M3 7.26e-39 132 47 2 147 3 smpB SsrA-binding protein Caulobacter sp. (strain K31)
A0PYP8 7.8e-39 132 46 1 144 3 smpB SsrA-binding protein Clostridium novyi (strain NT)
Q5NPL5 1.39e-38 131 45 2 148 3 smpB SsrA-binding protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A1VFF3 2.53e-38 130 47 2 153 3 smpB SsrA-binding protein Nitratidesulfovibrio vulgaris (strain DP4)
Q72DV1 2.53e-38 130 47 2 153 3 smpB SsrA-binding protein Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A6LR41 3.37e-38 130 42 1 155 3 smpB SsrA-binding protein Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q313K7 3.49e-38 130 47 3 158 3 smpB SsrA-binding protein Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2G8D5 6.67e-38 130 45 3 148 3 smpB SsrA-binding protein Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q03LI8 8.64e-38 129 44 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M570 8.64e-38 129 44 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0N4 8.64e-38 129 44 1 148 3 smpB SsrA-binding protein Streptococcus thermophilus (strain CNRZ 1066)
A8FHG7 1.01e-37 129 42 1 145 3 smpB SsrA-binding protein Bacillus pumilus (strain SAFR-032)
B2G624 1.31e-37 129 41 1 157 3 smpB SsrA-binding protein Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIJ0 1.31e-37 129 41 1 157 3 smpB SsrA-binding protein Limosilactobacillus reuteri (strain DSM 20016)
B0BZP2 1.83e-37 128 44 0 144 3 smpB SsrA-binding protein Acaryochloris marina (strain MBIC 11017)
A3DJ18 2.02e-37 128 47 1 134 3 smpB SsrA-binding protein Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
P59630 2.59e-37 128 43 1 147 3 smpB SsrA-binding protein Enterococcus faecalis (strain ATCC 700802 / V583)
Q7NKI3 3.32e-37 128 45 1 140 3 smpB SsrA-binding protein Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P66859 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella suis biovar 1 (strain 1330)
B0CKX3 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella suis (strain ATCC 23445 / NCTC 10510)
P66858 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHY9 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella melitensis biotype 2 (strain ATCC 23457)
A9MA22 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57E95 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella abortus biovar 1 (strain 9-941)
Q2YMY0 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella abortus (strain 2308)
B2SAC5 6.59e-37 127 42 2 155 3 smpB SsrA-binding protein Brucella abortus (strain S19)
Q898Q7 6.71e-37 127 42 2 160 3 smpB SsrA-binding protein Clostridium tetani (strain Massachusetts / E88)
B3CQP3 7.16e-37 127 45 4 148 3 smpB SsrA-binding protein Orientia tsutsugamushi (strain Ikeda)
Q16BP2 7.25e-37 127 45 2 150 3 smpB SsrA-binding protein Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B4U434 7.68e-37 127 43 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q0STE4 7.9e-37 127 40 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain SM101 / Type A)
Q8XKU7 7.9e-37 127 40 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain 13 / Type A)
Q0TQZ6 7.9e-37 127 40 2 160 3 smpB SsrA-binding protein Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C0MCH3 1.23e-36 126 43 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. zooepidemicus (strain H70)
A6X299 1.35e-36 126 42 2 155 3 smpB SsrA-binding protein Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B9KMM4 1.84e-36 126 46 3 156 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZG8 1.84e-36 126 46 3 156 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PMS9 1.84e-36 126 46 3 156 3 smpB SsrA-binding protein Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B9LD60 1.99e-36 126 42 1 158 3 smpB SsrA-binding protein Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WJ45 1.99e-36 126 42 1 158 3 smpB SsrA-binding protein Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A4VW67 2.09e-36 126 44 1 147 3 smpB SsrA-binding protein Streptococcus suis (strain 05ZYH33)
A4W2H3 2.09e-36 126 44 1 147 3 smpB SsrA-binding protein Streptococcus suis (strain 98HAH33)
A0ALD2 2.1e-36 125 43 1 143 3 smpB SsrA-binding protein Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66860 2.1e-36 125 43 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDA8 2.1e-36 125 43 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4a (strain HCC23)
Q71WX8 2.1e-36 125 43 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4b (strain F2365)
C1KY87 2.1e-36 125 43 1 143 3 smpB SsrA-binding protein Listeria monocytogenes serotype 4b (strain CLIP80459)
P66861 2.1e-36 125 43 1 143 3 smpB SsrA-binding protein Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
C0MAA1 2.11e-36 125 42 1 148 3 smpB SsrA-binding protein Streptococcus equi subsp. equi (strain 4047)
A5CCM6 2.15e-36 125 45 4 148 3 smpB SsrA-binding protein Orientia tsutsugamushi (strain Boryong)
Q2LU46 2.54e-36 125 44 3 158 3 smpB SsrA-binding protein Syntrophus aciditrophicus (strain SB)
A7GUR1 3.02e-36 125 41 1 150 3 smpB SsrA-binding protein Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5MZN2 3.38e-36 125 40 0 149 3 smpB SsrA-binding protein Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31M94 3.38e-36 125 40 0 149 3 smpB SsrA-binding protein Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1GDQ2 3.52e-36 125 43 3 158 3 smpB SsrA-binding protein Ruegeria sp. (strain TM1040)
A8M3R4 3.95e-36 125 45 1 144 3 smpB SsrA-binding protein Salinispora arenicola (strain CNS-205)
Q7X2N6 4.2e-36 125 44 2 146 3 smpB SsrA-binding protein Sphingomonas elodea
B3CPW2 4.62e-36 125 49 2 146 3 smpB SsrA-binding protein Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A4X3K9 4.97e-36 125 45 1 144 3 smpB SsrA-binding protein Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
C0R392 7.7e-36 124 47 3 148 3 smpB SsrA-binding protein Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73H09 7.7e-36 124 47 3 148 3 smpB SsrA-binding protein Wolbachia pipientis wMel
P66865 7.79e-36 124 44 1 147 3 smpB SsrA-binding protein Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66864 7.79e-36 124 44 1 147 3 smpB SsrA-binding protein Streptococcus agalactiae serotype III (strain NEM316)
Q3K035 7.79e-36 124 44 1 147 3 smpB SsrA-binding protein Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q112L2 8.28e-36 124 41 0 148 3 smpB SsrA-binding protein Trichodesmium erythraeum (strain IMS101)
Q6G467 9.27e-36 124 44 2 154 3 smpB SsrA-binding protein Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5LLW5 9.57e-36 124 44 2 155 3 smpB SsrA-binding protein Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q67SL8 1.14e-35 124 42 2 145 3 smpB SsrA-binding protein Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A2C637 1.15e-35 124 46 1 141 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9303)
Q985B9 1.27e-35 124 42 2 157 3 smpB SsrA-binding protein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q0BYG5 1.27e-35 124 45 3 158 3 smpB SsrA-binding protein Hyphomonas neptunium (strain ATCC 15444)
Q47M13 1.33e-35 124 44 1 154 3 smpB SsrA-binding protein Thermobifida fusca (strain YX)
Q3B0J2 1.4e-35 124 44 0 135 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9902)
Q7V911 1.42e-35 124 46 1 141 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9313)
Q1GSC9 1.43e-35 124 45 2 146 3 smpB SsrA-binding protein Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
C4L5G5 1.7e-35 124 43 2 157 3 smpB SsrA-binding protein Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B9MNR6 2e-35 123 43 1 144 3 smpB SsrA-binding protein Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q9RH74 2.01e-35 123 44 2 145 3 smpB SsrA-binding protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1J7Y3 2.03e-35 123 43 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M4 (strain MGAS10750)
A6Q524 2.11e-35 123 46 2 139 3 smpB SsrA-binding protein Nitratiruptor sp. (strain SB155-2)
B7IP12 2.21e-35 123 42 1 145 3 smpB SsrA-binding protein Bacillus cereus (strain G9842)
B9DTZ7 2.24e-35 123 43 1 146 3 smpB SsrA-binding protein Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q6G090 2.75e-35 123 42 2 154 3 smpB SsrA-binding protein Bartonella quintana (strain Toulouse)
Q214K5 2.79e-35 123 44 2 145 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisB18)
Q97L49 2.84e-35 123 43 1 145 3 smpB SsrA-binding protein Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A0LDB8 3.26e-35 122 43 1 143 3 smpB SsrA-binding protein Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A5VPI6 3.34e-35 123 41 2 155 3 smpB SsrA-binding protein Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A2RFZ7 3.57e-35 122 43 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M5 (strain Manfredo)
B8I8G4 3.58e-35 122 44 1 153 3 smpB SsrA-binding protein Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B9J4L7 4.25e-35 122 42 1 150 3 smpB SsrA-binding protein Bacillus cereus (strain Q1)
B7HW45 4.25e-35 122 42 1 150 3 smpB SsrA-binding protein Bacillus cereus (strain AH187)
Q72XZ2 4.25e-35 122 42 1 150 3 smpB SsrA-binding protein Bacillus cereus (strain ATCC 10987 / NRS 248)
Q30TF9 4.28e-35 122 41 1 146 3 smpB SsrA-binding protein Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
O32230 4.37e-35 122 37 1 153 1 smpB SsrA-binding protein Bacillus subtilis (strain 168)
A9IRK6 4.68e-35 122 43 2 154 3 smpB SsrA-binding protein Bartonella tribocorum (strain CIP 105476 / IBS 506)
A4XIH3 4.78e-35 122 43 1 144 3 smpB SsrA-binding protein Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8ENQ2 4.94e-35 122 43 2 154 3 smpB SsrA-binding protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2IWV3 5.18e-35 122 44 2 145 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain HaA2)
A9KPF1 5.24e-35 122 42 1 152 3 smpB SsrA-binding protein Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q7V9Q3 5.3e-35 122 43 1 144 3 smpB SsrA-binding protein Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A8I0D5 5.77e-35 122 39 2 158 3 smpB SsrA-binding protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A9G109 6.11e-35 122 42 3 161 3 smpB SsrA-binding protein Sorangium cellulosum (strain So ce56)
A7Z8U4 6.68e-35 122 40 1 150 3 smpB SsrA-binding protein Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B5XK94 6.7e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M49 (strain NZ131)
Q48UT9 6.7e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JI42 6.7e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XDD6 6.7e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9A126 6.7e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M1
P0DF81 7.08e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF80 7.08e-35 122 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q28WG4 8.24e-35 122 42 2 154 3 smpB SsrA-binding protein Jannaschia sp. (strain CCS1)
A5EKM6 9.02e-35 122 42 2 150 3 smpB SsrA-binding protein Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B2V9T6 9.92e-35 121 44 1 136 3 smpB SsrA-binding protein Sulfurihydrogenibium sp. (strain YO3AOP1)
Q815L5 1.04e-34 121 42 1 145 3 smpB SsrA-binding protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HEC5 1.04e-34 121 42 1 145 3 smpB SsrA-binding protein Bacillus cereus (strain B4264)
A4YWD7 1.12e-34 121 42 2 151 3 smpB SsrA-binding protein Bradyrhizobium sp. (strain ORS 278)
A5FZS6 1.17e-34 121 45 2 144 3 smpB SsrA-binding protein Acidiphilium cryptum (strain JF-5)
Q88YG7 1.19e-34 121 39 2 157 3 smpB SsrA-binding protein Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q03SK9 1.36e-34 121 42 3 158 3 smpB SsrA-binding protein Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q6HBG1 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q631M9 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus cereus (strain ZK / E33L)
C1EZ92 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus cereus (strain 03BB102)
B7JFF5 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus cereus (strain AH820)
Q81XA8 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus anthracis
A0RKR7 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus thuringiensis (strain Al Hakam)
C3LDE9 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P072 1.37e-34 121 41 1 150 3 smpB SsrA-binding protein Bacillus anthracis (strain A0248)
A9BD59 1.4e-34 121 44 0 137 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9211)
B8G4V8 1.42e-34 121 41 1 156 3 smpB SsrA-binding protein Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q8DSZ5 1.47e-34 121 44 1 152 3 smpB SsrA-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B8CYF2 1.55e-34 121 40 1 148 3 smpB SsrA-binding protein Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A8MFY7 1.65e-34 121 43 2 144 3 smpB SsrA-binding protein Alkaliphilus oremlandii (strain OhILAs)
A7IM13 1.78e-34 121 43 3 158 3 smpB SsrA-binding protein Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P43659 1.81e-34 121 41 1 147 3 smpB SsrA-binding protein Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
Q3A3J2 1.82e-34 120 43 1 148 3 smpB SsrA-binding protein Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B9JC66 2.2e-34 120 43 2 158 3 smpB SsrA-binding protein Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2KAF1 2.2e-34 120 42 2 158 3 smpB SsrA-binding protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PUN0 2.2e-34 120 42 2 158 3 smpB SsrA-binding protein Rhizobium etli (strain CIAT 652)
Q8DHM0 2.22e-34 120 42 0 145 3 smpB SsrA-binding protein Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A9NF97 2.22e-34 120 42 1 147 3 smpB SsrA-binding protein Acholeplasma laidlawii (strain PG-8A)
Q1JMZ7 3.14e-34 120 41 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JD22 3.14e-34 120 41 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M12 (strain MGAS2096)
B0KA44 3.56e-34 120 45 1 135 3 smpB SsrA-binding protein Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q11JT6 3.69e-34 120 44 2 145 3 smpB SsrA-binding protein Chelativorans sp. (strain BNC1)
A1A0L5 3.75e-34 120 43 3 161 3 smpB SsrA-binding protein Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A1AZQ0 3.88e-34 120 44 2 151 3 smpB SsrA-binding protein Paracoccus denitrificans (strain Pd 1222)
B0K718 3.97e-34 120 45 1 135 3 smpB SsrA-binding protein Thermoanaerobacter sp. (strain X514)
A9VQ41 4.35e-34 120 41 1 145 3 smpB SsrA-binding protein Bacillus mycoides (strain KBAB4)
Q1MRU5 5.46e-34 120 43 1 148 3 smpB SsrA-binding protein Lawsonia intracellularis (strain PHE/MN1-00)
Q2JM08 6.11e-34 119 47 0 148 3 smpB SsrA-binding protein Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JV45 6.45e-34 119 47 0 148 3 smpB SsrA-binding protein Synechococcus sp. (strain JA-3-3Ab)
Q7U9W8 6.62e-34 120 42 0 135 3 smpB SsrA-binding protein Parasynechococcus marenigrum (strain WH8102)
Q3AND9 8.32e-34 119 43 0 137 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9605)
A7GZ96 8.69e-34 119 41 1 144 3 smpB SsrA-binding protein Campylobacter curvus (strain 525.92)
A5GI45 9.02e-34 119 42 0 132 3 smpB SsrA-binding protein Synechococcus sp. (strain WH7803)
B6JGA6 9.43e-34 119 42 4 157 3 smpB SsrA-binding protein Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q5GTK2 1.04e-33 119 46 2 146 3 smpB SsrA-binding protein Wolbachia sp. subsp. Brugia malayi (strain TRS)
A3PFA6 1.04e-33 119 45 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9301)
Q8P244 1.16e-33 119 42 1 146 3 smpB SsrA-binding protein Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q136W8 1.28e-33 119 42 2 145 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisB5)
B2IDQ9 1.36e-33 119 44 4 153 3 smpB SsrA-binding protein Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q0IDW2 1.38e-33 119 42 0 132 3 smpB SsrA-binding protein Synechococcus sp. (strain CC9311)
A3CP85 1.45e-33 119 42 1 147 3 smpB SsrA-binding protein Streptococcus sanguinis (strain SK36)
A8AW61 1.45e-33 119 42 1 147 3 smpB SsrA-binding protein Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A2BTJ8 1.63e-33 119 45 0 135 3 smpB SsrA-binding protein Prochlorococcus marinus (strain AS9601)
Q3YT18 1.63e-33 118 44 2 145 3 smpB SsrA-binding protein Ehrlichia canis (strain Jake)
Q318C5 1.76e-33 119 42 0 143 3 smpB SsrA-binding protein Prochlorococcus marinus (strain MIT 9312)
Q8UGL2 2.82e-33 118 43 2 157 3 smpB SsrA-binding protein Agrobacterium fabrum (strain C58 / ATCC 33970)
A8LKQ3 3.11e-33 118 45 3 148 3 smpB SsrA-binding protein Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A7HGZ0 3.54e-33 118 44 1 140 3 smpB SsrA-binding protein Anaeromyxobacter sp. (strain Fw109-5)
Q46IJ5 3.62e-33 118 40 0 155 3 smpB SsrA-binding protein Prochlorococcus marinus (strain NATL2A)
B2IPC9 3.65e-33 117 41 1 148 3 smpB SsrA-binding protein Streptococcus pneumoniae (strain CGSP14)
Q97R56 3.65e-33 117 41 1 148 3 smpB SsrA-binding protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C4XJ76 3.79e-33 117 42 2 153 3 smpB SsrA-binding protein Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q38VS0 4.06e-33 117 42 4 157 3 smpB SsrA-binding protein Latilactobacillus sakei subsp. sakei (strain 23K)
A2C564 4.35e-33 117 41 0 147 3 smpB SsrA-binding protein Prochlorococcus marinus (strain NATL1A)
Q1AVL3 4.58e-33 117 43 1 143 3 smpB SsrA-binding protein Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A0LVP0 5.26e-33 117 41 1 146 3 smpB SsrA-binding protein Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A5V3L8 5.65e-33 117 39 2 146 3 smpB SsrA-binding protein Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A8GWS0 5.74e-33 117 43 2 144 3 smpB SsrA-binding protein Rickettsia bellii (strain OSU 85-389)
A4J8T4 5.81e-33 117 38 2 157 3 smpB SsrA-binding protein Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B7GUE4 5.95e-33 117 45 2 151 3 smpB SsrA-binding protein Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G540 5.95e-33 117 45 2 151 3 smpB SsrA-binding protein Bifidobacterium longum (strain NCC 2705)
B3DTB5 5.95e-33 117 45 2 151 3 smpB SsrA-binding protein Bifidobacterium longum (strain DJO10A)
Q1RIJ4 6.44e-33 117 43 2 144 3 smpB SsrA-binding protein Rickettsia bellii (strain RML369-C)
A7HX37 6.57e-33 117 41 3 155 3 smpB SsrA-binding protein Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
C1CK57 6.57e-33 117 41 1 148 3 smpB SsrA-binding protein Streptococcus pneumoniae (strain P1031)
C0QUM8 6.65e-33 117 43 1 139 3 smpB SsrA-binding protein Persephonella marina (strain DSM 14350 / EX-H1)
A6Q776 6.77e-33 117 42 1 145 3 smpB SsrA-binding protein Sulfurovum sp. (strain NBC37-1)
Q07M67 6.95e-33 117 42 2 145 3 smpB SsrA-binding protein Rhodopseudomonas palustris (strain BisA53)
B1I1B6 7.47e-33 117 42 1 141 3 smpB SsrA-binding protein Desulforudis audaxviator (strain MP104C)
Q9CEW2 7.48e-33 117 40 2 160 3 smpB SsrA-binding protein Lactococcus lactis subsp. lactis (strain IL1403)
Q2S237 9.24e-33 116 44 2 135 3 smpB SsrA-binding protein Salinibacter ruber (strain DSM 13855 / M31)
B5ZW65 9.24e-33 117 41 2 158 3 smpB SsrA-binding protein Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C3M8R6 9.34e-33 117 41 2 157 3 smpB SsrA-binding protein Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1QL45 9.42e-33 116 41 2 145 3 smpB SsrA-binding protein Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q1DAN7 9.52e-33 117 39 2 157 3 smpB SsrA-binding protein Myxococcus xanthus (strain DK1622)
A0RNV4 1.1e-32 116 42 1 141 3 smpB SsrA-binding protein Campylobacter fetus subsp. fetus (strain 82-40)
Q184Z6 1.39e-32 116 43 2 144 3 smpB SsrA-binding protein Clostridioides difficile (strain 630)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09405
Feature type CDS
Gene smpB
Product SsrA-binding protein SmpB
Location 2050361 - 2050843 (strand: 1)
Length 483 (nucleotides) / 160 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2371
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01668 SmpB protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0691 Posttranslational modification, protein turnover, chaperones (O) O tmRNA-binding protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03664 SsrA-binding protein - -

Protein Sequence

MTKKKSHKPGSATIALNKRARHEYFIEDEIEAGLSLQGWEVKSLRAGKANISDSYVIMRDGEAYLFGATITPLNVASTHVVCDPTRTRKLLLKQRELANLYGQINRDGYTVVALSLYWKNAWCKIKIGVAKGKKDHDKRDTIKDREWKLDKARIMKNANR

Flanking regions ( +/- flanking 50bp)

GACGCTTAAATGATTTCTTTCTATTGCTCATACAGTATAATGTGGAAATTATGACAAAGAAAAAATCACACAAACCCGGCTCTGCCACTATTGCACTCAATAAACGTGCTCGCCATGAATATTTCATTGAAGATGAAATCGAAGCGGGACTGTCGTTACAGGGCTGGGAAGTTAAATCACTGCGTGCGGGTAAAGCCAATATCAGTGATAGCTATGTAATCATGCGTGATGGTGAGGCGTACCTGTTTGGTGCCACCATTACACCGTTAAACGTTGCCTCTACTCATGTTGTTTGTGATCCGACACGTACGCGTAAACTGTTATTAAAACAACGTGAATTAGCTAATCTCTATGGCCAAATAAACCGTGATGGTTACACCGTGGTTGCCCTTTCCTTATATTGGAAAAATGCATGGTGTAAAATCAAAATTGGCGTAGCTAAAGGTAAAAAAGATCACGATAAGCGTGACACCATAAAAGATCGTGAGTGGAAATTAGACAAAGCACGGATCATGAAAAATGCTAACCGCTAAATTGCGTTAACTACTAGCAATAGCAGGTATTTTTCTGATATACTCACTTT