Homologs in group_3087

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18885 FBDBKF_18885 100.0 Morganella morganii S1 cbiF cobalt-precorrin-4 methyltransferase
NLDBIP_18460 NLDBIP_18460 100.0 Morganella morganii S4 cbiF cobalt-precorrin-4 methyltransferase
LHKJJB_09165 LHKJJB_09165 100.0 Morganella morganii S3 cbiF cobalt-precorrin-4 methyltransferase
HKOGLL_08715 HKOGLL_08715 100.0 Morganella morganii S5 cbiF cobalt-precorrin-4 methyltransferase
F4V73_RS13710 F4V73_RS13710 93.8 Morganella psychrotolerans - cobalt-precorrin-4 methyltransferase

Distribution of the homologs in the orthogroup group_3087

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3087

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A2G9 6.49e-131 373 70 0 257 1 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2H0 6.49e-131 373 70 0 257 3 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Salmonella typhi
Q58973 5.68e-96 285 55 1 255 3 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O87696 3.07e-71 222 43 1 255 1 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Priestia megaterium
P21922 1.33e-62 199 42 3 248 1 cobM Precorrin-4 C(11)-methyltransferase Sinorhizobium sp.
Q9HZP9 5.53e-54 177 42 3 247 3 cobM Precorrin-4 C(11)-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O68100 1.33e-52 174 41 4 248 1 cobM Precorrin-4 C(11)-methyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P9WGB1 2.25e-52 173 41 2 240 1 cobM Precorrin-4 C(11)-methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGB0 2.25e-52 173 41 2 240 3 cobM Precorrin-4 C(11)-methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q53138 6.49e-50 167 39 3 241 3 cobM Precorrin-4 C(11)-methyltransferase Rhodococcus erythropolis
P29928 8.08e-31 117 32 4 233 1 cobA Uroporphyrinogen-III C-methyltransferase Priestia megaterium
A9H259 1.78e-27 113 31 4 235 3 cysG Siroheme synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A1WWP8 3.74e-27 112 31 3 232 3 cysG1 Siroheme synthase 1 Halorhodospira halophila (strain DSM 244 / SL1)
Q5FP95 2.17e-26 110 30 4 235 3 cysG Siroheme synthase Gluconobacter oxydans (strain 621H)
Q3SG32 2.33e-26 110 29 4 240 3 cysG Siroheme synthase Thiobacillus denitrificans (strain ATCC 25259)
Q4FSU1 7.56e-26 108 31 5 233 3 cysG Siroheme synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QAX7 1.31e-25 108 30 5 233 3 cysG Siroheme synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
P42437 1.62e-25 107 28 3 239 2 nasF Uroporphyrinogen-III C-methyltransferase Bacillus subtilis (strain 168)
Q9I2W4 1.71e-25 103 29 5 232 3 cobA Uroporphyrinogen-III C-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1JSB7 2.4e-25 107 30 5 234 3 cysG2 Siroheme synthase 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3KA85 3.98e-25 106 30 4 234 3 cysG Siroheme synthase Pseudomonas fluorescens (strain Pf0-1)
Q0AHC1 1.15e-24 105 27 4 233 3 cysG Siroheme synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q58375 1.32e-24 101 29 5 225 3 cobA Uroporphyrinogen-III C-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6D1A4 1.66e-24 104 31 6 243 3 cysG1 Siroheme synthase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C3JY53 1.69e-24 104 30 4 233 3 cysG Siroheme synthase Pseudomonas fluorescens (strain SBW25)
O34744 2.05e-24 101 27 3 241 2 sumT Uroporphyrinogen-III C-methyltransferase Bacillus subtilis (strain 168)
Q6CZS0 2.62e-24 103 30 5 240 3 cysG2 Siroheme synthase 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q820Q4 2.67e-24 104 28 5 239 3 cysG Siroheme synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1JBD9 7.64e-24 102 29 5 233 3 cysG Siroheme synthase Pseudomonas putida (strain W619)
A1JJS8 1.03e-23 102 30 6 243 3 cysG1 Siroheme synthase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C1DKY7 1.13e-23 102 29 4 234 3 cysG Siroheme synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1KU10 1.43e-23 102 30 4 234 3 cysG Siroheme synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P21631 1.75e-23 99 27 3 236 1 cobA Uroporphyrinogen-III C-methyltransferase Sinorhizobium sp.
P57001 1.96e-23 102 30 4 234 3 cysG Siroheme synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A5WEG6 2.52e-23 101 30 7 233 3 cysG Siroheme synthase Psychrobacter sp. (strain PRwf-1)
Q88FT3 2.68e-23 101 28 4 233 3 cysG Siroheme synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B3GZA0 2.71e-23 101 30 5 232 3 cysG Siroheme synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
P95370 3.51e-23 101 30 4 234 3 cysG Siroheme synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A5W1H7 4.68e-23 100 28 4 233 3 cysG Siroheme synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1AVU5 5.5e-23 100 28 4 234 3 cysG Siroheme synthase Ruthia magnifica subsp. Calyptogena magnifica
A9LZ77 5.52e-23 100 30 4 234 3 cysG Siroheme synthase Neisseria meningitidis serogroup C (strain 053442)
Q4ZRL6 7.85e-23 100 31 5 234 3 cysG Siroheme synthase Pseudomonas syringae pv. syringae (strain B728a)
Q7N8L2 9.98e-23 99 33 6 239 3 cysG Siroheme synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2Y6L7 1.01e-22 99 28 4 238 3 cysG Siroheme synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1H3L5 1.13e-22 99 27 4 234 3 cysG Siroheme synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q21K21 1.36e-22 99 28 5 233 3 cysG Siroheme synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q48H75 1.53e-22 99 30 5 234 3 cysG Siroheme synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0BTC2 1.7e-22 99 30 5 232 3 cysG Siroheme synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q6F8G6 1.77e-22 99 29 4 234 3 cysG Siroheme synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A4XUX3 2.03e-22 99 28 4 234 3 cysG Siroheme synthase Pseudomonas mendocina (strain ymp)
Q664M6 2.54e-22 98 29 4 234 3 cysG2 Siroheme synthase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FNS9 2.54e-22 98 29 4 234 3 cysG2 Siroheme synthase 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TGU8 2.89e-22 98 29 4 234 3 cysG1 Siroheme synthase 1 Yersinia pestis (strain Pestoides F)
Q74Y23 2.95e-22 98 29 4 234 3 cysG Siroheme synthase Yersinia pestis
Q1C2P9 2.95e-22 98 29 4 234 3 cysG Siroheme synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CCP6 2.95e-22 98 29 4 234 3 cysG2 Siroheme synthase 2 Yersinia pestis bv. Antiqua (strain Nepal516)
B7UW11 2.99e-22 98 28 4 234 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain LESB58)
Q9I0M7 3.14e-22 98 28 4 234 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A5CXE4 3.62e-22 98 29 4 233 3 cysG Siroheme synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q4K9V8 3.65e-22 98 29 4 233 3 cysG Siroheme synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A7MJ67 4.48e-22 97 28 4 238 3 cysG1 Siroheme synthase 1 Cronobacter sakazakii (strain ATCC BAA-894)
A6V4H6 5.99e-22 97 28 4 234 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain PA7)
Q87ZT0 6.83e-22 97 29 5 234 3 cysG Siroheme synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O19889 1.06e-21 94 27 3 233 3 cobA Uroporphyrinogen-III C-methyltransferase Cyanidium caldarium
Q15YU1 1.42e-21 96 30 5 238 3 cysG Siroheme synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7WB57 1.75e-21 96 29 4 236 3 cysG Siroheme synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMM4 1.75e-21 96 29 4 236 3 cysG Siroheme synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q46BL0 2.01e-21 93 32 4 234 1 Mbar_A1791 S-adenosyl-L-methionine-dependent uroporphyrinogen III methyltransferase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q493N1 2.01e-21 96 29 7 234 3 cysG Siroheme synthase Blochmanniella pennsylvanica (strain BPEN)
A4VLU6 2.44e-21 95 28 5 235 3 cysG Siroheme synthase Stutzerimonas stutzeri (strain A1501)
A4TPZ1 2.89e-21 95 32 6 233 3 cysG2 Siroheme synthase 2 Yersinia pestis (strain Pestoides F)
Q66EC9 2.89e-21 95 32 6 233 3 cysG1 Siroheme synthase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CLS2 2.89e-21 95 32 6 233 3 cysG1 Siroheme synthase 1 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FLY4 3.03e-21 95 32 6 233 3 cysG1 Siroheme synthase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1IBC9 3.14e-21 95 27 4 233 3 cysG Siroheme synthase Pseudomonas entomophila (strain L48)
B7LS75 3.74e-21 95 28 5 237 3 cysG Siroheme synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q02NA3 4.72e-21 95 28 4 234 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q3ILQ9 6.31e-21 94 26 5 243 3 cysG Siroheme synthase Pseudoalteromonas translucida (strain TAC 125)
B1LHG9 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain SMS-3-5 / SECEC)
P0AEA8 6.64e-21 94 28 5 237 1 cysG Siroheme synthase Escherichia coli (strain K12)
B1IP96 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5H5 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O9:H4 (strain HS)
B1X716 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain K12 / DH10B)
C4ZUM4 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain K12 / MC4100 / BW2952)
P0AEA9 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O157:H7
B7L4P2 6.64e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain 55989 / EAEC)
B7NMD7 7.18e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NDX8 7.54e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YTS6 7.54e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q31VS0 7.68e-21 94 28 5 237 3 cysG Siroheme synthase Shigella boydii serotype 4 (strain Sb227)
B2U3H4 7.68e-21 94 28 5 237 3 cysG Siroheme synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YWQ3 7.76e-21 94 28 5 237 3 cysG Siroheme synthase Shigella sonnei (strain Ss046)
Q83JB3 7.76e-21 94 28 5 237 3 cysG Siroheme synthase Shigella flexneri
Q0SZU8 7.76e-21 94 28 5 237 3 cysG Siroheme synthase Shigella flexneri serotype 5b (strain 8401)
B6I2S7 7.83e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain SE11)
B7M1S1 7.83e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O8 (strain IAI1)
A7ZSP4 7.83e-21 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
C5BGP8 7.83e-21 94 29 6 239 3 cysG Siroheme synthase Edwardsiella ictaluri (strain 93-146)
B7N1F1 8.22e-21 94 29 5 237 3 cysG Siroheme synthase Escherichia coli O81 (strain ED1a)
A8GKQ1 9.23e-21 94 29 5 232 3 cysG2 Siroheme synthase 2 Serratia proteamaculans (strain 568)
A6VPZ6 1.04e-20 94 29 5 231 3 cysG Siroheme synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0TC92 1.17e-20 94 28 5 237 3 cysG Siroheme synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1WYD5 1.24e-20 94 31 6 264 3 cysG2 Siroheme synthase 2 Halorhodospira halophila (strain DSM 244 / SL1)
Q8FCW8 1.26e-20 93 28 5 237 3 cysG Siroheme synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UK79 1.26e-20 93 28 5 237 3 cysG Siroheme synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R5R3 1.35e-20 93 28 5 237 3 cysG Siroheme synthase Escherichia coli (strain UTI89 / UPEC)
A1AGQ2 1.35e-20 93 28 5 237 3 cysG Siroheme synthase Escherichia coli O1:K1 / APEC
B7MCY5 1.35e-20 93 28 5 237 3 cysG Siroheme synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
P37725 1.38e-20 90 26 4 234 3 cobA Uroporphyrinogen-III C-methyltransferase Pseudomonas fluorescens
Q9PF46 1.43e-20 93 28 4 241 3 cysG Siroheme synthase Xylella fastidiosa (strain 9a5c)
Q2SJB7 1.78e-20 93 27 4 226 3 cysG Siroheme synthase Hahella chejuensis (strain KCTC 2396)
Q2KWB0 1.81e-20 93 28 4 234 3 cysG Siroheme synthase Bordetella avium (strain 197N)
A7MKK9 2.51e-20 92 29 5 234 3 cysG2 Siroheme synthase 2 Cronobacter sakazakii (strain ATCC BAA-894)
Q87AI5 3.64e-20 92 28 4 241 3 cysG Siroheme synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I985 3.64e-20 92 28 4 241 3 cysG Siroheme synthase Xylella fastidiosa (strain M23)
Q3JCS0 4.16e-20 92 26 4 237 3 cysG Siroheme synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q32AZ8 6.2e-20 91 28 5 237 3 cysG Siroheme synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q7VZ77 7.5e-20 91 28 4 236 3 cysG Siroheme synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A6TF07 7.97e-20 91 26 4 237 3 cysG2 Siroheme synthase 2 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A0KQJ4 8.93e-20 91 28 5 238 3 cysG3 Siroheme synthase 3 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7VQG9 1.3e-19 90 26 3 230 3 cysG Siroheme synthase Blochmanniella floridana
Q65T49 1.34e-19 90 29 4 230 3 cysG Siroheme synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5F8J0 1.34e-19 90 28 7 250 3 cysG Siroheme synthase Salmonella agona (strain SL483)
Q31GG8 1.43e-19 90 25 3 231 3 cysG Siroheme synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0A812 1.59e-19 90 27 4 240 3 cysG Siroheme synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q55749 1.82e-19 88 27 3 232 3 cobA Uroporphyrinogen-III C-methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A9MME5 2.06e-19 90 29 5 237 3 cysG Siroheme synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q606C9 2.24e-19 90 27 6 237 3 cysG Siroheme synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B0U4X0 3.25e-19 89 27 4 241 3 cysG Siroheme synthase Xylella fastidiosa (strain M12)
Q0VQ05 3.35e-19 89 26 4 241 3 cysG Siroheme synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B5FJQ1 3.57e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella dublin (strain CT_02021853)
A1SRP9 3.59e-19 89 31 5 222 3 cysG Siroheme synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C0Q0F3 3.6e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella paratyphi C (strain RKS4594)
A9MT45 3.6e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R2C7 3.6e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella enteritidis PT4 (strain P125109)
Q57IZ5 3.6e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella choleraesuis (strain SC-B67)
B4TKQ4 3.85e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella heidelberg (strain SL476)
B5R7N6 3.85e-19 89 28 6 248 3 cysG Siroheme synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4SVI1 3.89e-19 89 28 5 237 3 cysG Siroheme synthase Salmonella newport (strain SL254)
A8AQS4 4.2e-19 89 28 6 240 3 cysG Siroheme synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q42606 4.58e-19 88 26 4 234 1 UPM1 S-adenosyl-L-methionine-dependent uroporphyrinogen III methyltransferase, chloroplastic Arabidopsis thaliana
A4WFH1 4.95e-19 89 28 5 233 3 cysG Siroheme synthase Enterobacter sp. (strain 638)
Q7NZV7 5e-19 89 30 4 233 3 cysG Siroheme synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9HZV6 5.37e-19 89 28 4 244 3 cysG Siroheme synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q8Z201 7.42e-19 88 28 5 233 3 cysG Siroheme synthase Salmonella typhi
B4TY38 1.2e-18 88 28 5 237 3 cysG Siroheme synthase Salmonella schwarzengrund (strain CVM19633)
B5BH22 1.24e-18 88 28 5 233 3 cysG Siroheme synthase Salmonella paratyphi A (strain AKU_12601)
Q5PLV8 1.24e-18 88 28 5 233 3 cysG Siroheme synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P25924 1.3e-18 87 28 5 233 1 cysG Siroheme synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0KLD7 5.13e-18 86 28 5 237 3 cysG1 Siroheme synthase 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5NRM4 1.06e-17 85 28 5 245 3 cysG Siroheme synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q59294 1.22e-17 85 28 5 234 3 hemD Porphyrin biosynthesis protein HemD Ruminiclostridium josui
A4SHL4 1.34e-17 85 27 5 234 3 cysG1 Siroheme synthase 1 Aeromonas salmonicida (strain A449)
P57500 1.65e-17 84 28 4 211 3 cysG Siroheme synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0KP37 1.98e-17 84 29 5 235 3 cysG2 Siroheme synthase 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q1LTP4 2.32e-17 84 30 5 222 3 cysG Siroheme synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
P29564 3.38e-17 81 29 5 215 1 cobA Uroporphyrinogen-III C-methyltransferase Methanobacterium ivanovii
A4SRH0 4.97e-17 83 29 5 235 3 cysG2 Siroheme synthase 2 Aeromonas salmonicida (strain A449)
A8G9Y3 8.63e-17 82 30 5 204 3 cysG1 Siroheme synthase 1 Serratia proteamaculans (strain 568)
B8GUD3 4.62e-16 80 23 5 253 3 cysG Siroheme synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C4LAG5 9.96e-15 76 28 5 239 3 cysG Siroheme synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6TD45 1.67e-14 75 29 5 232 3 cysG1 Siroheme synthase 1 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
O74468 7.22e-14 74 24 4 233 2 SPCC1739.06c Probable uroporphyrinogen-III C-methyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P42451 1.07e-13 72 25 6 218 3 cobA Uroporphyrinogen-III C-methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2NVN0 4.15e-13 72 30 6 233 3 cysG Siroheme synthase Sodalis glossinidius (strain morsitans)
Q6LM67 1.55e-12 70 25 6 243 3 cysG Siroheme synthase Photobacterium profundum (strain SS9)
P36150 8.68e-12 68 23 5 234 1 MET1 Uroporphyrinogen-III C-methyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q51701 1.51e-10 63 28 6 235 3 nirE Uroporphyrinogen-III C-methyltransferase Paracoccus denitrificans (strain Pd 1222)
Q58917 0.000102 45 25 9 207 3 cbiE Probable cobalt-precorrin-7 C(5)-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O29534 0.000175 45 29 3 124 3 cbiHC Cobalamin biosynthesis protein CbiHC Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17080
Feature type CDS
Gene cbiF
Product cobalt-precorrin-4 methyltransferase
Location 21222 - 22001 (strand: -1)
Length 780 (nucleotides) / 259 (amino acids)

Contig

Accession ZDB_231
Length 52966 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3087
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00590 Tetrapyrrole (Corrin/Porphyrin) Methylases

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2875 Coenzyme transport and metabolism (H) H Precorrin-4 methylase

Kegg Ortholog Annotation(s)

Protein Sequence

MAEQFDRQKVWFVGAGPGDISLITLKGYRILQQADIVIYAGSLINTDLLDYCKDGVESYDSAAMTLDDIITVMVDGVKSHKLVVRLQTGDLSLYGSIREQGEVLAEHNIGFSAIPGVSSFLGAAAELGVEYTVPEVSQSLIITRIEGRTPMPPKESLRSFAAHQTSMAIFLSVQDIKGVVEQLTEGGYPETTPVAVVYKATWPDCQVLRSTLAEITVAVREAKIRKTALILVGPFLGDEYHYSKLYDAGFSHEYRKASR

Flanking regions ( +/- flanking 50bp)

TAAACCGAATAATCCTACCTATCTTATTTCCTGCCGTAAGGAGGCGCGTTGTGGCTGAACAGTTTGACCGTCAGAAAGTCTGGTTTGTCGGAGCCGGTCCCGGGGATATCAGTCTTATCACCCTGAAAGGCTACCGTATTTTACAACAGGCTGACATCGTCATTTATGCCGGTTCGCTTATCAATACTGATCTGCTGGACTACTGCAAAGACGGCGTCGAAAGCTACGACAGCGCCGCCATGACCCTCGACGACATCATCACTGTGATGGTTGACGGCGTGAAAAGCCACAAACTGGTGGTGCGTCTGCAGACCGGCGACCTCTCCCTGTACGGCTCTATCCGTGAACAGGGCGAAGTGCTGGCAGAACACAATATCGGCTTCAGCGCGATCCCGGGCGTTAGTTCCTTCCTCGGTGCCGCAGCCGAACTGGGTGTGGAATACACCGTACCGGAAGTATCCCAGAGCCTGATTATCACCCGTATCGAAGGCCGCACACCGATGCCGCCGAAAGAGAGTCTGCGCAGCTTTGCCGCTCACCAGACCTCAATGGCGATTTTCCTGTCTGTTCAGGATATCAAAGGCGTGGTGGAGCAACTGACCGAAGGCGGTTATCCGGAAACTACCCCGGTCGCCGTGGTGTATAAAGCGACCTGGCCGGATTGTCAGGTGCTGCGCAGCACACTGGCGGAAATCACCGTCGCCGTGCGCGAAGCAAAAATCCGCAAAACCGCACTGATTCTGGTCGGGCCGTTCCTCGGCGACGAGTATCACTATTCAAAACTGTATGACGCAGGCTTCAGCCATGAGTACCGCAAAGCCTCGCGGTAAGCGCATTGCGCTGTTTTGCCTGACACCGGGCGGCAAAGCGCTGGCGGAAA