Homologs in group_335

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10645 FBDBKF_10645 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_14810 NLDBIP_14810 100.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_14535 LHKJJB_14535 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_13155 HKOGLL_13155 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS14355 F4V73_RS14355 96.1 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS08915 PMI_RS08915 46.2 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS10885 PMI_RS10885 41.6 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_335

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_335

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9ZD50 1.69e-10 57 38 0 68 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
Q92HV3 6.9e-10 55 36 0 68 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P0C5S2 3.93e-09 53 39 0 69 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 3.93e-09 53 39 0 69 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P15017 1.73e-08 51 32 0 90 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q8TZX4 9.85e-07 48 33 0 60 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O59472 4.7e-06 46 32 0 58 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P55681 6.65e-06 45 33 0 69 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P9WMI1 1.65e-05 45 33 0 66 1 ramB HTH-type transcriptional regulator RamB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMI0 1.65e-05 45 33 0 66 3 ramB HTH-type transcriptional regulator RamB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9V1R0 3.57e-05 44 27 2 88 3 PYRAB03670 Putative HTH-type transcriptional regulatory protein PYRAB03670 Pyrococcus abyssi (strain GE5 / Orsay)
P96631 0.0001 41 24 0 61 1 immR HTH-type transcriptional regulator ImmR Bacillus subtilis (strain 168)
P55360 0.000247 40 34 0 69 4 NGR_a00350 Uncharacterized HTH-type transcriptional regulator y4aM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q97QZ2 0.000562 40 32 1 68 1 pezA Antitoxin PezA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5JF28 0.000711 40 30 0 55 3 TK0539 Putative HTH-type transcriptional regulatory protein TK0539 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14980
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 95174 - 95485 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)

Contig

Accession ZDB_225
Length 129223 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_335
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MTKAKNSIARAVGQKIQVLRKDHGITAARLAEMIEISQQQMSRYERGVNRVDVDCLVRIADIFEVPVGWFFTEIEGRGKRDSGNERESWKAETVILPVESELM

Flanking regions ( +/- flanking 50bp)

ATCAGAGAGGAATCTGATGGTTATCACAGCCATATGTGAGGGATAGCGACATGACCAAAGCAAAAAACTCGATAGCACGCGCCGTCGGGCAAAAAATTCAGGTGTTACGAAAAGATCACGGCATTACTGCAGCAAGACTGGCTGAAATGATTGAAATCAGTCAGCAGCAGATGTCACGTTATGAACGTGGTGTAAACCGTGTTGATGTGGATTGTTTAGTCCGTATTGCGGATATCTTTGAAGTACCGGTTGGCTGGTTCTTCACCGAGATTGAAGGCCGGGGTAAACGCGACAGCGGAAATGAACGGGAATCCTGGAAAGCAGAAACCGTTATTTTGCCGGTCGAATCTGAACTGATGTAATTTCGTGATATTGAGTGATACTGAATCTCATCTCAAAAATCCGTTATTAG