Homologs in group_4747

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4747

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4747

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57720 2.33e-08 49 38 0 63 4 MJ0272 Uncharacterized HTH-type transcriptional regulator MJ0272 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P55409 6.15e-06 43 38 0 67 4 NGR_a04070 Uncharacterized HTH-type transcriptional regulator y4dJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92HV3 1.96e-05 43 42 0 49 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P15017 2.26e-05 42 38 0 60 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q9ZD50 6.63e-05 42 40 0 49 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
P0C5S2 9.41e-05 42 31 0 66 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 9.41e-05 42 31 0 66 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
O28481 0.00012 40 36 0 63 4 AF_1793 Uncharacterized HTH-type transcriptional regulator AF_1793 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P55681 0.000175 41 31 1 73 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q58564 0.000228 41 31 3 92 3 MJ1164 Putative HTH-type transcriptional regulatory protein MJ1164 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O34647 0.00034 40 28 0 74 4 yobD Uncharacterized HTH-type transcriptional regulator YobD Bacillus subtilis (strain 168)
Q8ZWT6 0.000558 40 28 0 92 3 PAE1627 Putative HTH-type transcriptional regulatory protein PAE1627 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q97QZ2 0.000686 39 35 0 64 1 pezA Antitoxin PezA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10885
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 2398350 - 2398643 (strand: -1)
Length 294 (nucleotides) / 97 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4747
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MNRSYPASKMVGKKIAYYRRVNGLTLSELAKKIGISQQQQSRYERGINRVSLDRLYQYACFFGISLSDLFQLDDEDKVEIENKISNIIGNKNESFNK

Flanking regions ( +/- flanking 50bp)

TCTTGAATTTACTCTTATTTATAATTAAATGTGTCATAAAGGGGTTTCAAGTGAATCGCTCTTATCCAGCATCAAAGATGGTAGGAAAAAAAATCGCTTATTACCGTAGGGTTAATGGCCTCACATTAAGTGAATTGGCTAAGAAAATAGGTATAAGTCAACAGCAGCAATCAAGATATGAACGGGGAATTAATCGAGTGAGTCTAGATAGGCTTTATCAATATGCTTGCTTTTTCGGTATTAGTTTAAGTGATCTTTTTCAATTAGATGATGAAGATAAAGTAGAAATAGAAAATAAAATATCAAATATAATAGGGAATAAAAATGAATCATTTAATAAATAAAAAAATTTTTTTATTAGCTACATTATTGTTTTTCTCAGCTAACTCCTTTG