Homologs in group_947

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05170 FBDBKF_05170 100.0 Morganella morganii S1 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
NLDBIP_12760 NLDBIP_12760 100.0 Morganella morganii S4 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
LHKJJB_12620 LHKJJB_12620 100.0 Morganella morganii S3 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
HKOGLL_11235 HKOGLL_11235 100.0 Morganella morganii S5 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
F4V73_RS05625 F4V73_RS05625 83.5 Morganella psychrotolerans trpCF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
PMI_RS06495 PMI_RS06495 58.9 Proteus mirabilis HI4320 trpCF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF

Distribution of the homologs in the orthogroup group_947

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_947

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KST5 0.0 523 59 2 450 3 trpCF Tryptophan biosynthesis protein TrpCF Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZEG8 0.0 522 59 2 451 3 trpC Tryptophan biosynthesis protein TrpCF Yersinia pestis
Q8X7B7 0.0 520 60 0 450 3 trpC Tryptophan biosynthesis protein TrpCF Escherichia coli O157:H7
P00909 0.0 518 59 0 450 1 trpC Tryptophan biosynthesis protein TrpCF Escherichia coli (strain K12)
P00910 4.03e-176 503 58 0 447 3 trpC Tryptophan biosynthesis protein TrpCF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7D9 5.98e-176 503 58 0 447 3 trpC Tryptophan biosynthesis protein TrpCF Salmonella typhi
P22098 1.05e-167 483 55 3 453 3 trpC Tryptophan biosynthesis protein TrpCF Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P46451 3.16e-164 474 53 4 463 3 trpC Tryptophan biosynthesis protein TrpCF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57855 3.25e-162 469 53 5 464 3 trpC Tryptophan biosynthesis protein TrpCF Pasteurella multocida (strain Pm70)
P42393 4.54e-158 457 49 1 450 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57366 2.43e-156 453 48 0 450 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O68427 1.55e-150 439 46 2 454 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Diuraphis noxia
Q44603 8.75e-145 424 46 4 455 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Schlechtendalia chinensis
P59459 1.39e-134 399 44 3 445 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O25867 1.12e-131 390 45 5 448 3 trpC Tryptophan biosynthesis protein TrpCF Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJU8 2.29e-131 390 47 5 448 3 trpC Tryptophan biosynthesis protein TrpCF Helicobacter pylori (strain J99 / ATCC 700824)
P06560 1.19e-96 301 41 9 463 1 trpC Tryptophan biosynthesis protein TrpCF Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q5ZX99 5.12e-58 194 42 3 255 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X6S0 5.12e-58 194 42 3 255 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila (strain Paris)
A5IG82 5.95e-58 194 42 3 255 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila (strain Corby)
Q5WY75 1.1e-57 194 42 3 255 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila (strain Lens)
Q123F4 4.99e-57 192 43 4 257 3 trpC Indole-3-glycerol phosphate synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
C5CKE4 8.28e-57 191 44 5 251 3 trpC Indole-3-glycerol phosphate synthase Variovorax paradoxus (strain S110)
A1VTG7 2.99e-56 190 43 6 262 3 trpC Indole-3-glycerol phosphate synthase Polaromonas naphthalenivorans (strain CJ2)
A1TJQ2 6.31e-56 189 43 6 264 3 trpC Indole-3-glycerol phosphate synthase Paracidovorax citrulli (strain AAC00-1)
P26938 4.41e-54 184 42 4 258 3 trpC Indole-3-glycerol phosphate synthase Azospirillum brasilense
A9BS06 5.49e-54 184 40 5 264 3 trpC Indole-3-glycerol phosphate synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
B5ERI2 7.24e-54 184 46 5 250 3 trpC Indole-3-glycerol phosphate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBC0 7.24e-54 184 46 5 250 3 trpC Indole-3-glycerol phosphate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8XVE6 3.66e-53 182 45 3 226 3 trpC1 Indole-3-glycerol phosphate synthase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q21SE8 3.81e-53 182 43 6 260 3 trpC Indole-3-glycerol phosphate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1W2Z8 5.32e-53 182 44 3 227 3 trpC Indole-3-glycerol phosphate synthase Acidovorax sp. (strain JS42)
B9JX64 5.47e-53 182 42 5 262 3 trpC Indole-3-glycerol phosphate synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B9MBS5 2.13e-52 180 44 3 227 3 trpC Indole-3-glycerol phosphate synthase Acidovorax ebreus (strain TPSY)
A4G1P4 2.72e-52 180 41 5 264 3 trpC Indole-3-glycerol phosphate synthase Herminiimonas arsenicoxydans
B4SLE8 3.01e-52 179 41 5 262 3 trpC Indole-3-glycerol phosphate synthase Stenotrophomonas maltophilia (strain R551-3)
Q319J2 8.31e-52 179 42 8 264 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9312)
B2FKL1 1.09e-51 178 42 6 264 3 trpC Indole-3-glycerol phosphate synthase Stenotrophomonas maltophilia (strain K279a)
A1WH73 1.37e-51 178 43 6 264 3 trpC Indole-3-glycerol phosphate synthase Verminephrobacter eiseniae (strain EF01-2)
Q97EF3 3.01e-51 177 41 4 246 3 trpC Indole-3-glycerol phosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A3DDS7 4.57e-51 176 42 3 218 3 trpC Indole-3-glycerol phosphate synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8PQ47 6.87e-51 176 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
A8G6A7 1.07e-50 176 41 8 266 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9215)
Q98ME3 1.12e-50 176 42 4 261 3 trpC Indole-3-glycerol phosphate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3BYB5 1.88e-50 175 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q92370 1.91e-50 186 30 16 513 2 trp1 Multifunctional tryptophan biosynthesis protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A8Z6K1 1.94e-50 175 37 3 260 3 trpC Indole-3-glycerol phosphate synthase Campylobacter concisus (strain 13826)
B2UDK9 2.5e-50 174 44 3 226 3 trpC Indole-3-glycerol phosphate synthase Ralstonia pickettii (strain 12J)
B1Y7I2 3.11e-50 174 41 4 254 3 trpC Indole-3-glycerol phosphate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q7NUI6 4.51e-50 174 41 5 261 3 trpC Indole-3-glycerol phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5FPM3 4.74e-50 174 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A2BSL8 5.36e-50 175 41 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain AS9601)
Q7VU67 7.16e-50 173 45 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8PD70 7.17e-50 173 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UZF8 7.17e-50 173 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
Q7W387 8.66e-50 173 45 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WEK6 8.66e-50 173 45 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9ZFA7 9.68e-50 173 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3ZZ14 1.01e-49 173 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Dehalococcoides mccartyi (strain CBDB1)
Q2NYD7 1.19e-49 173 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SL03 1.42e-49 172 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q9PGT5 1.51e-49 172 43 4 240 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain 9a5c)
B9KMV0 1.66e-49 172 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q87EX2 1.82e-49 172 43 4 240 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6S5 1.82e-49 172 43 4 240 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain M23)
Q3Z6G5 2.76e-49 172 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A9HY11 3.56e-49 171 43 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A3PHK7 3.58e-49 172 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A3PED0 3.68e-49 172 41 8 264 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9301)
C3MCF2 3.8e-49 172 44 3 227 3 trpC Indole-3-glycerol phosphate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2G6R0 4.54e-49 171 41 5 258 3 trpC Indole-3-glycerol phosphate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q11HU1 5e-49 171 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Chelativorans sp. (strain BNC1)
Q55508 5.49e-49 172 42 9 268 3 trpC Indole-3-glycerol phosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6SUH5 6.02e-49 171 39 5 263 3 trpC Indole-3-glycerol phosphate synthase Janthinobacterium sp. (strain Marseille)
Q5P2G1 6.17e-49 171 39 4 257 3 trpC Indole-3-glycerol phosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q88A03 7.35e-49 171 41 6 266 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0U1P0 7.57e-49 171 42 4 240 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain M12)
Q1MGE1 8.15e-49 171 42 3 229 3 trpC Indole-3-glycerol phosphate synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A9BBR3 8.46e-49 171 39 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9211)
Q0K6I0 8.87e-49 171 38 5 263 3 trpC Indole-3-glycerol phosphate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A7HXZ6 1.14e-48 170 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
P94327 1.45e-48 170 40 5 264 3 trpC Indole-3-glycerol phosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B5ZPY7 1.55e-48 170 43 3 229 3 trpC Indole-3-glycerol phosphate synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B9JFD8 1.59e-48 170 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1GZC0 1.65e-48 169 40 3 234 3 trpC Indole-3-glycerol phosphate synthase Endomicrobium trichonymphae
Q7M831 1.74e-48 170 40 4 254 3 trpC Indole-3-glycerol phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P24920 1.74e-48 177 30 20 529 3 TRP1 Tryptophan biosynthesis protein TRP1 Phytophthora nicotianae
B3R703 2e-48 170 39 5 263 3 trpC Indole-3-glycerol phosphate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B1XSZ1 2.22e-48 169 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A6X0L0 2.55e-48 169 42 3 226 3 trpC Indole-3-glycerol phosphate synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1KAT2 2.74e-48 169 41 6 260 3 trpC Indole-3-glycerol phosphate synthase Azoarcus sp. (strain BH72)
A8I836 3.12e-48 169 44 3 225 3 trpC Indole-3-glycerol phosphate synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8EJS1 3.95e-48 169 42 3 226 3 trpC Indole-3-glycerol phosphate synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1JE34 5.93e-48 169 42 9 271 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain W619)
Q3SGS2 7.19e-48 168 41 4 257 3 trpC Indole-3-glycerol phosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
C1DHY7 9.42e-48 168 39 5 263 3 trpC Indole-3-glycerol phosphate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4SG41 9.89e-48 167 41 5 248 3 trpC Indole-3-glycerol phosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q7VAT3 1.09e-47 169 42 8 264 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3K5V4 1.1e-47 168 40 7 271 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas fluorescens (strain Pf0-1)
A5N7N8 2.8e-47 166 35 4 256 3 trpC Indole-3-glycerol phosphate synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E149 2.8e-47 166 35 4 256 3 trpC Indole-3-glycerol phosphate synthase Clostridium kluyveri (strain NBRC 12016)
B3Q6M9 3.24e-47 166 41 4 250 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain TIE-1)
Q8XS01 4.08e-47 166 43 3 230 3 trpC2 Indole-3-glycerol phosphate synthase 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2RT48 4.72e-47 166 43 7 262 3 trpC Indole-3-glycerol phosphate synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5USQ4 5.12e-47 166 39 7 264 3 trpC Indole-3-glycerol phosphate synthase Roseiflexus sp. (strain RS-1)
A2BY04 5.2e-47 167 40 8 266 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9515)
Q46WU7 5.98e-47 166 38 6 264 3 trpC Indole-3-glycerol phosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q4K503 1.16e-46 165 40 7 271 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q2IWB0 1.3e-46 165 41 5 251 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain HaA2)
A5VBA0 1.86e-46 164 41 5 259 3 trpC Indole-3-glycerol phosphate synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A8ET36 1.97e-46 164 36 3 257 3 trpC Indole-3-glycerol phosphate synthase Aliarcobacter butzleri (strain RM4018)
Q92PR9 2.15e-46 164 39 5 266 3 trpC Indole-3-glycerol phosphate synthase Rhizobium meliloti (strain 1021)
A4SV52 2.35e-46 164 39 5 251 3 trpC Indole-3-glycerol phosphate synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B4RBX5 2.7e-46 164 40 4 256 3 trpC Indole-3-glycerol phosphate synthase Phenylobacterium zucineum (strain HLK1)
P66989 3.04e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella suis biovar 1 (strain 1330)
P66988 3.04e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJB1 3.04e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5F4 3.04e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CZ8 3.04e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella abortus biovar 1 (strain 9-941)
Q2YRR4 3.04e-46 164 38 5 272 1 trpC Indole-3-glycerol phosphate synthase Brucella abortus (strain 2308)
B2S5Z1 3.04e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella abortus (strain S19)
B0CGT9 3.07e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQR5 3.75e-46 164 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P20578 3.89e-46 164 40 8 270 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida
A5VXL5 4.06e-46 164 40 8 270 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C1D7J7 5.24e-46 163 40 5 259 3 trpC Indole-3-glycerol phosphate synthase Laribacter hongkongensis (strain HLHK9)
Q7UKJ7 5.54e-46 163 38 5 257 3 trpC Indole-3-glycerol phosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B3QZD6 5.82e-46 163 42 5 252 3 trpC Indole-3-glycerol phosphate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A7GYQ7 5.92e-46 163 38 4 260 3 trpC Indole-3-glycerol phosphate synthase Campylobacter curvus (strain 525.92)
C4Z138 6.2e-46 163 38 3 249 3 trpC Indole-3-glycerol phosphate synthase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q48NP7 7.42e-46 163 41 6 267 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q88QR6 8.02e-46 163 40 8 270 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A0RNN3 8.83e-46 162 38 4 254 3 trpC Indole-3-glycerol phosphate synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q5N575 9.59e-46 163 44 5 225 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q8KPR4 9.59e-46 163 44 5 225 3 trpC Indole-3-glycerol phosphate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A5GRL0 1.05e-45 163 40 8 265 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain RCC307)
B2IKL7 1.07e-45 163 43 4 223 3 trpC Indole-3-glycerol phosphate synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C3K307 1.13e-45 163 38 5 266 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas fluorescens (strain SBW25)
Q136D2 1.13e-45 162 43 3 221 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain BisB5)
A4WX67 1.16e-45 162 40 3 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A6Q3P0 1.32e-45 162 37 4 257 3 trpC Indole-3-glycerol phosphate synthase Nitratiruptor sp. (strain SB155-2)
B2JHI8 1.36e-45 162 37 4 258 3 trpC Indole-3-glycerol phosphate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q7TU64 1.58e-45 163 39 8 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q10ZM7 1.72e-45 163 38 7 268 3 trpC Indole-3-glycerol phosphate synthase Trichodesmium erythraeum (strain IMS101)
A4JB67 1.76e-45 162 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A6UZF2 2.4e-45 162 40 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain PA7)
Q9XBM3 2.49e-45 161 43 4 223 3 trpC Indole-3-glycerol phosphate synthase Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)
Q47AC7 3.23e-45 161 40 5 260 3 trpC Indole-3-glycerol phosphate synthase Dechloromonas aromatica (strain RCB)
A4VHK1 3.54e-45 161 40 4 260 3 trpC Indole-3-glycerol phosphate synthase Stutzerimonas stutzeri (strain A1501)
P20409 4.07e-45 171 32 19 531 3 trp1 Multifunctional tryptophan biosynthesis protein Phycomyces blakesleeanus
B7V609 5.33e-45 161 39 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain LESB58)
B0VUS0 5.56e-45 160 39 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain SDF)
P20577 5.91e-45 161 39 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TB5 7.22e-45 160 39 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7TTU3 8.06e-45 161 40 8 267 3 trpC Indole-3-glycerol phosphate synthase Parasynechococcus marenigrum (strain WH8102)
Q1IFZ9 9.78e-45 160 38 6 268 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas entomophila (strain L48)
Q215B9 1.14e-44 160 44 3 223 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain BisB18)
A4XZC5 1.24e-44 160 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas mendocina (strain ymp)
Q2K879 1.37e-44 159 42 3 229 3 trpC Indole-3-glycerol phosphate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B0K8T4 1.49e-44 159 40 3 205 3 trpC Indole-3-glycerol phosphate synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0KK35 2.04e-44 159 39 7 266 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain GB-1)
Q5F645 2.41e-44 159 42 4 223 3 trpC Indole-3-glycerol phosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B2HVE7 2.51e-44 159 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain ACICU)
B0VBS1 2.59e-44 159 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain AYE)
A3M785 2.59e-44 159 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7I441 2.59e-44 159 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain AB0057)
Q3AU73 3.27e-44 158 38 6 260 3 trpC Indole-3-glycerol phosphate synthase Chlorobium chlorochromatii (strain CaD3)
Q3SRJ3 3.32e-44 158 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B3Q0L3 4.34e-44 158 42 3 229 3 trpC Indole-3-glycerol phosphate synthase Rhizobium etli (strain CIAT 652)
A7NMZ8 5.1e-44 158 39 7 264 3 trpC Indole-3-glycerol phosphate synthase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B4RPF1 5.35e-44 158 43 3 207 3 trpC Indole-3-glycerol phosphate synthase Neisseria gonorrhoeae (strain NCCP11945)
Q1BSD2 5.98e-44 157 42 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia orbicola (strain AU 1054)
B1JUU5 5.98e-44 157 42 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia orbicola (strain MC0-3)
A0K458 5.98e-44 157 42 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia cenocepacia (strain HI2424)
Q9K192 6.67e-44 157 42 3 207 3 trpC Indole-3-glycerol phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q0BIM8 6.93e-44 157 41 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B0K2U1 7.17e-44 157 39 3 205 3 trpC Indole-3-glycerol phosphate synthase Thermoanaerobacter sp. (strain X514)
Q3ABS1 7.28e-44 157 37 6 264 3 trpC Indole-3-glycerol phosphate synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q5NQ36 9.66e-44 157 39 6 262 3 trpC Indole-3-glycerol phosphate synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A4IQ84 1e-43 157 40 6 259 3 trpC Indole-3-glycerol phosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
A9AJ43 1.24e-43 157 42 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia multivorans (strain ATCC 17616 / 249)
B1WQE4 1.26e-43 158 41 9 271 3 trpC Indole-3-glycerol phosphate synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q3AV87 1.33e-43 158 38 7 263 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain CC9902)
Q39JZ7 1.34e-43 157 42 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9JSN4 1.48e-43 157 42 3 207 3 trpC Indole-3-glycerol phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A6U9C5 1.62e-43 157 38 5 266 3 trpC Indole-3-glycerol phosphate synthase Sinorhizobium medicae (strain WSM419)
A1KRV4 1.8e-43 156 42 3 207 3 trpC Indole-3-glycerol phosphate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
O67657 1.92e-43 156 41 4 220 3 trpC Indole-3-glycerol phosphate synthase Aquifex aeolicus (strain VF5)
A1BDW1 2.13e-43 156 40 6 260 3 trpC Indole-3-glycerol phosphate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B1YSF5 2.19e-43 156 41 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia ambifaria (strain MC40-6)
B8GWP9 2.83e-43 156 38 4 258 3 trpC Indole-3-glycerol phosphate synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A727 2.83e-43 156 38 4 258 3 trpC Indole-3-glycerol phosphate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P00911 3.16e-43 156 37 4 259 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A8FEK0 4.61e-43 155 37 6 247 3 trpC Indole-3-glycerol phosphate synthase Bacillus pumilus (strain SAFR-032)
Q5KXU9 4.61e-43 155 40 7 260 3 trpC Indole-3-glycerol phosphate synthase Geobacillus kaustophilus (strain HTA426)
B0SYZ4 4.98e-43 155 38 4 258 3 trpC Indole-3-glycerol phosphate synthase Caulobacter sp. (strain K31)
B0CEU2 7.65e-43 156 39 8 257 3 trpC Indole-3-glycerol phosphate synthase Acaryochloris marina (strain MBIC 11017)
Q2KU99 1.01e-42 154 41 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella avium (strain 197N)
B7K0H0 1.08e-42 155 39 8 263 3 trpC Indole-3-glycerol phosphate synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q7CYR2 1.29e-42 154 41 3 225 3 trpC Indole-3-glycerol phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q30SM1 1.35e-42 154 33 3 262 3 trpC Indole-3-glycerol phosphate synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q8R9M7 1.48e-42 154 39 3 239 3 trpC Indole-3-glycerol phosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B6JG29 1.52e-42 154 41 5 259 3 trpC Indole-3-glycerol phosphate synthase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A1VYK3 1.78e-42 154 37 5 259 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A4T9N5 2.59e-42 154 38 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium gilvum (strain PYR-GCK)
B8HP79 3.07e-42 154 38 6 252 3 trpC Indole-3-glycerol phosphate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A9KL43 3.1e-42 153 37 3 220 3 trpC Indole-3-glycerol phosphate synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q9KCB2 3.27e-42 153 39 4 246 3 trpC Indole-3-glycerol phosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P06531 3.31e-42 162 29 15 518 2 trpC Multifunctional tryptophan biosynthesis protein Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q3B2C7 3.37e-42 153 40 6 252 3 trpC Indole-3-glycerol phosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A6TM74 3.96e-42 153 40 3 222 3 trpC Indole-3-glycerol phosphate synthase Alkaliphilus metalliredigens (strain QYMF)
P24773 4.1e-42 162 29 14 483 3 trpC Multifunctional tryptophan biosynthesis protein Penicillium chrysogenum
Q3AL94 6.5e-42 153 38 8 263 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain CC9605)
Q8AAD6 6.92e-42 152 38 5 245 3 trpC Indole-3-glycerol phosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q07NF6 9.78e-42 152 38 4 258 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain BisA53)
Q5HVR3 1.03e-41 152 37 5 259 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni (strain RM1221)
Q9PI11 1.03e-41 152 37 5 259 1 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKS2 1.03e-41 152 37 5 259 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B4SDV8 1.48e-41 151 43 3 213 3 trpC Indole-3-glycerol phosphate synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q1QMJ9 2.35e-41 151 40 5 254 3 trpC Indole-3-glycerol phosphate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A7H4P0 2.82e-41 150 37 5 259 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B2SZ04 3.4e-41 150 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
P00908 4.13e-41 159 30 17 521 3 trp-1 Multifunctional tryptophan biosynthesis protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A7INK2 7.83e-41 149 43 2 214 3 trpC Indole-3-glycerol phosphate synthase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q13TW4 8.95e-41 149 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Paraburkholderia xenovorans (strain LB400)
A3NDZ3 1.55e-40 149 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain 668)
Q3JNB0 1.93e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain 1710b)
A5EVG3 1.98e-40 149 35 4 263 3 trpC Indole-3-glycerol phosphate synthase Dichelobacter nodosus (strain VCS1703A)
A1UWA0 2.76e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain SAVP1)
Q62DD0 2.76e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain ATCC 23344)
A2RYI3 2.76e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain NCTC 10229)
A3MFQ4 2.76e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain NCTC 10247)
Q63QH0 2.84e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain K96243)
A3NZP6 2.84e-40 148 41 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain 1106a)
B3EG28 3.13e-40 147 38 5 249 3 trpC Indole-3-glycerol phosphate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q46JH4 3.47e-40 149 39 9 264 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain NATL2A)
Q7NHI0 3.62e-40 149 36 7 272 3 trpC Indole-3-glycerol phosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A2CB59 3.82e-40 149 39 8 268 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9303)
B1MBV4 3.95e-40 148 38 4 265 3 trpC Indole-3-glycerol phosphate synthase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A2C462 4.01e-40 149 39 9 264 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain NATL1A)
P0CN87 4.53e-40 156 29 15 489 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
Q88WI2 5.17e-40 147 37 4 246 3 trpC Indole-3-glycerol phosphate synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P70937 5.51e-40 147 38 6 247 3 trpC Indole-3-glycerol phosphate synthase Priestia megaterium (strain ATCC 12872 / QMB1551)
Q6AMS4 5.62e-40 147 41 3 217 3 trpC Indole-3-glycerol phosphate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A1T8X3 7.61e-40 147 37 5 264 3 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q2SUI0 8.65e-40 147 40 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A7I2Y2 8.92e-40 147 36 4 257 3 trpC Indole-3-glycerol phosphate synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q1ISJ1 9.74e-40 146 38 4 260 3 trpC Indole-3-glycerol phosphate synthase Koribacter versatilis (strain Ellin345)
A6WC91 9.86e-40 147 36 5 272 3 trpC Indole-3-glycerol phosphate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
C4KZ66 1.02e-39 146 41 5 219 3 trpC Indole-3-glycerol phosphate synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A4YVD6 1.2e-39 147 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Bradyrhizobium sp. (strain ORS 278)
B8I0V0 1.25e-39 146 38 2 216 3 trpC Indole-3-glycerol phosphate synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B9LAF4 1.43e-39 146 36 2 220 3 trpC Indole-3-glycerol phosphate synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A5EK25 1.43e-39 146 39 5 260 3 trpC Indole-3-glycerol phosphate synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q7TV44 1.55e-39 147 39 8 268 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9313)
C5D3D6 1.64e-39 146 36 5 263 3 trpC Indole-3-glycerol phosphate synthase Geobacillus sp. (strain WCH70)
P0CN86 2.18e-39 154 29 17 501 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
A4J147 3.41e-39 145 38 4 221 3 trpC Indole-3-glycerol phosphate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P03964 5.35e-39 144 39 7 245 3 trpC Indole-3-glycerol phosphate synthase Bacillus subtilis (strain 168)
B0JTM2 1.52e-38 144 39 6 225 3 trpC Indole-3-glycerol phosphate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A0QX95 2.1e-38 143 36 6 269 1 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0IC57 3.64e-38 143 43 9 266 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain CC9311)
Q03X00 5.63e-38 142 37 3 218 3 trpC Indole-3-glycerol phosphate synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1B7H6 1.18e-37 141 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium sp. (strain MCS)
A1UHJ6 1.18e-37 141 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium sp. (strain KMS)
A3Q119 1.18e-37 141 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium sp. (strain JLS)
Q8F7V2 1.18e-37 140 36 3 246 3 trpC Indole-3-glycerol phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NP6 1.18e-37 140 36 3 246 3 trpC Indole-3-glycerol phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
O68814 1.38e-37 141 36 4 260 3 trpC1 Indole-3-glycerol phosphate synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P27710 2.03e-37 148 29 14 470 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
C1AT55 2.19e-37 140 40 3 214 3 trpC Indole-3-glycerol phosphate synthase Rhodococcus opacus (strain B4)
A7Z618 2.2e-37 140 37 6 247 3 trpC Indole-3-glycerol phosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0SHZ5 3.31e-37 140 39 3 214 3 trpC Indole-3-glycerol phosphate synthase Rhodococcus jostii (strain RHA1)
C1CT53 4.53e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain Taiwan19F-14)
Q740P4 5.23e-37 139 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QHH0 5.23e-37 139 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium avium (strain 104)
C1CMD5 5.29e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain P1031)
B2ISS3 5.29e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain CGSP14)
Q97P30 5.29e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZN61 5.29e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B5E7M5 5.29e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae serotype 19F (strain G54)
C1CG44 5.92e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain JJA)
Q8DNM6 5.92e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04IY7 5.92e-37 139 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A1SL44 5.95e-37 139 37 3 254 3 trpC Indole-3-glycerol phosphate synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
C1C968 1.31e-36 138 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain 70585)
B1I7S9 1.38e-36 138 40 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain Hungary19A-6)
Q8KBW1 2.04e-36 137 36 5 250 3 trpC Indole-3-glycerol phosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q56319 2.69e-36 137 35 3 230 1 trpC Indole-3-glycerol phosphate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P9WFX7 2.81e-36 137 36 4 263 1 trpC Indole-3-glycerol phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U2W7 2.81e-36 137 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1ANN3 2.81e-36 137 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJ27 2.81e-36 137 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A633 2.81e-36 137 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B3W6W8 3.2e-36 137 35 4 245 3 trpC Indole-3-glycerol phosphate synthase Lacticaseibacillus casei (strain BL23)
A1R5S7 4.42e-36 137 39 2 193 3 trpC Indole-3-glycerol phosphate synthase Paenarthrobacter aurescens (strain TC1)
Q03CY1 6.39e-36 136 35 4 245 3 trpC Indole-3-glycerol phosphate synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A8AW03 6.43e-36 136 35 4 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P9WFX6 6.54e-36 137 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A9BHQ5 7.51e-36 136 35 5 247 3 trpC Indole-3-glycerol phosphate synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
B2HQX7 9.37e-36 136 35 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
P49572 1.16e-35 139 36 9 264 1 IGPS Indole-3-glycerol phosphate synthase, chloroplastic Arabidopsis thaliana
A3CLL9 1.35e-35 135 35 4 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus sanguinis (strain SK36)
P17217 1.65e-35 135 35 4 245 3 trpC Indole-3-glycerol phosphate synthase Lacticaseibacillus casei
Q65I33 2.01e-35 135 36 6 247 3 trpC Indole-3-glycerol phosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B3QLY7 2.07e-35 135 34 5 250 3 trpC Indole-3-glycerol phosphate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2S1Z5 2.42e-35 135 35 5 257 3 trpC Indole-3-glycerol phosphate synthase Salinibacter ruber (strain DSM 13855 / M31)
Q58328 2.64e-35 135 35 9 266 3 trpC Indole-3-glycerol phosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P25170 2.73e-35 142 30 17 525 3 TRPC Multifunctional tryptophan biosynthesis protein Phanerodontia chrysosporium
Q8TVJ8 2.74e-35 134 35 4 223 3 trpC Indole-3-glycerol phosphate synthase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8CPB2 2.81e-35 134 36 4 246 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
C5CBK6 2.95e-35 135 35 4 257 3 trpC Indole-3-glycerol phosphate synthase Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q0RFX9 4.43e-35 134 39 3 219 3 trpC Indole-3-glycerol phosphate synthase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q4L677 4.57e-35 134 37 3 212 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus haemolyticus (strain JCSC1435)
Q06121 4.68e-35 134 34 4 226 1 trpC Indole-3-glycerol phosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5HPH2 1.17e-34 133 35 4 246 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49XH6 1.3e-34 133 35 3 246 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1W0N8 1.71e-34 132 35 4 256 3 trpC Indole-3-glycerol phosphate synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q6GH35 1.74e-34 132 38 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain MRSA252)
A0PP28 2.11e-34 132 35 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium ulcerans (strain Agy99)
A8ZZX0 2.42e-34 132 35 8 265 3 trpC Indole-3-glycerol phosphate synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A5GMK4 3.54e-34 132 40 8 264 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain WH7803)
Q02584 5.81e-34 131 41 5 224 3 trpC Indole-3-glycerol phosphate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q82A84 8.13e-34 131 34 3 255 3 trpC Indole-3-glycerol phosphate synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P26939 8.9e-34 131 33 6 248 3 trpC Indole-3-glycerol phosphate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q9X7C7 8.92e-34 131 37 3 221 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium leprae (strain TN)
B8ZRB9 8.92e-34 131 37 3 221 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium leprae (strain Br4923)
O27694 1.02e-33 130 34 5 241 3 trpC Indole-3-glycerol phosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q47QR5 1.1e-33 130 38 4 243 3 trpC Indole-3-glycerol phosphate synthase Thermobifida fusca (strain YX)
A6QGS2 1.32e-33 130 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain Newman)
Q9RL78 1.32e-33 130 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain COL)
A0JVL1 1.49e-33 130 37 2 193 3 trpC Indole-3-glycerol phosphate synthase Arthrobacter sp. (strain FB24)
Q5WGS3 1.71e-33 129 39 3 203 3 trpC Indole-3-glycerol phosphate synthase Shouchella clausii (strain KSM-K16)
Q8DVF5 2.25e-33 129 33 3 242 3 trpC Indole-3-glycerol phosphate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8NWU3 2.37e-33 129 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain MW2)
A8Z242 2.37e-33 129 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9I9 2.37e-33 129 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain MSSA476)
Q2FYR6 2.37e-33 129 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH66 2.37e-33 129 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain USA300)
Q8Y6Q4 2.44e-33 129 35 4 253 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0C1A2 3.39e-33 129 37 4 248 3 trpC Indole-3-glycerol phosphate synthase Hyphomonas neptunium (strain ATCC 15444)
B7JES8 3.47e-33 129 35 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain AH820)
Q81TM0 3.47e-33 129 35 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus anthracis
C3LAW0 3.47e-33 129 35 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3T8 3.47e-33 129 35 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus anthracis (strain A0248)
Q01999 4.23e-33 129 33 5 257 3 trpC Indole-3-glycerol phosphate synthase Lactococcus lactis subsp. lactis (strain IL1403)
P00937 6.4e-33 133 35 9 269 1 TRP3 Multifunctional tryptophan biosynthesis protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P66991 1.02e-32 127 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain N315)
P66990 1.02e-32 127 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISQ2 1.02e-32 127 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain JH9)
A6U1J2 1.02e-32 127 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain JH1)
A7X234 1.02e-32 127 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8LGR8 1.18e-32 127 34 5 248 3 trpC Indole-3-glycerol phosphate synthase Parafrankia sp. (strain EAN1pec)
Q2YXU9 1.44e-32 127 37 5 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P18483 1.49e-32 134 29 13 482 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus awamori
Q81GG7 1.75e-32 127 35 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HLU6 2.06e-32 127 35 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IU36 2.14e-32 126 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain Q1)
B7I0F0 2.14e-32 126 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain AH187)
A0AJ82 2.62e-32 126 34 4 253 3 trpC Indole-3-glycerol phosphate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5LYI5 2.62e-32 126 33 4 254 3 trpC Indole-3-glycerol phosphate synthase Streptococcus thermophilus (strain CNRZ 1066)
Q63EC9 2.66e-32 126 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain ZK / E33L)
Q8ESU2 2.74e-32 126 36 6 254 3 trpC Indole-3-glycerol phosphate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A0LA39 3.34e-32 126 34 6 262 3 trpC Indole-3-glycerol phosphate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q03JB9 3.75e-32 126 33 4 254 3 trpC Indole-3-glycerol phosphate synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M348 3.87e-32 126 35 2 217 3 trpC Indole-3-glycerol phosphate synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q972A1 4.17e-32 125 37 5 204 3 trpC Indole-3-glycerol phosphate synthase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
B7IM74 6.01e-32 125 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain G9842)
A4FLL0 7.65e-32 125 34 6 272 3 trpC Indole-3-glycerol phosphate synthase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
C1ELE8 1.14e-31 124 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain 03BB102)
A0RB62 1.14e-31 124 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus thuringiensis (strain Al Hakam)
B7HGZ9 1.15e-31 124 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain B4264)
Q4J8X3 1.23e-31 124 37 4 210 3 trpC Indole-3-glycerol phosphate synthase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9Z4X0 1.47e-31 124 41 2 219 3 trpC2 Indole-3-glycerol phosphate synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P05328 1.88e-31 131 29 14 482 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus niger
A9VJW0 2.64e-31 124 34 6 249 3 trpC Indole-3-glycerol phosphate synthase Bacillus mycoides (strain KBAB4)
C5BV85 3.86e-31 124 36 4 257 3 trpC Indole-3-glycerol phosphate synthase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q02YB4 4.07e-31 123 35 3 217 3 trpC Indole-3-glycerol phosphate synthase Lactococcus lactis subsp. cremoris (strain SK11)
A2RK21 4.07e-31 123 35 3 217 3 trpC Indole-3-glycerol phosphate synthase Lactococcus lactis subsp. cremoris (strain MG1363)
Q71Z38 9.66e-31 122 35 2 217 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
C1KVS7 9.66e-31 122 35 2 217 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q9YGB5 9.69e-31 121 37 4 218 3 trpC Indole-3-glycerol phosphate synthase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
B1YLS2 1.09e-30 122 37 5 240 3 trpC Indole-3-glycerol phosphate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q92B79 1.27e-30 122 34 4 241 3 trpC Indole-3-glycerol phosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B7KC08 1.48e-30 120 37 6 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Gloeothece citriformis (strain PCC 7424)
B8DHB2 1.66e-30 121 35 2 217 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serotype 4a (strain HCC23)
Q9HSC1 1.49e-29 119 39 7 226 3 trpC Indole-3-glycerol phosphate synthase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
A4YHD8 3.14e-29 118 31 4 247 3 trpC Indole-3-glycerol phosphate synthase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q2JPT2 7.87e-29 116 37 6 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus sp. (strain JA-2-3B'a(2-13))
B0CA72 2.04e-28 115 36 7 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Acaryochloris marina (strain MBIC 11017)
B1ZW79 3.66e-28 115 36 7 255 3 trpC Indole-3-glycerol phosphate synthase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
P18304 3.94e-28 115 35 4 209 3 trpC Indole-3-glycerol phosphate synthase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A0LJ58 8.16e-28 114 31 4 247 3 trpC Indole-3-glycerol phosphate synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q10XS2 5.29e-27 111 33 5 220 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Trichodesmium erythraeum (strain IMS101)
Q6AF68 5.71e-27 112 38 4 198 3 trpC Indole-3-glycerol phosphate synthase Leifsonia xyli subsp. xyli (strain CTCB07)
B0JNJ4 8.44e-27 110 37 6 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q31R79 1.6e-26 109 39 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A4VKF4 1.9e-26 109 36 6 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Stutzerimonas stutzeri (strain A1501)
Q5N322 2.72e-26 108 39 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q28LA8 3.47e-26 108 37 7 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Jannaschia sp. (strain CCS1)
Q2W020 5.62e-26 108 35 6 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8U088 6.09e-26 108 34 4 221 3 trpC Indole-3-glycerol phosphate synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q2JW90 6.11e-26 108 38 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus sp. (strain JA-3-3Ab)
Q8ZYX2 8.48e-26 108 34 6 226 3 trpC Indole-3-glycerol phosphate synthase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q73BQ9 9.74e-26 108 34 5 251 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9PDK5 9.96e-26 107 35 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain 9a5c)
Q92411 1.07e-25 114 30 13 399 3 TRP1 Multifunctional tryptophan biosynthesis protein Cochliobolus heterostrophus
C1DQD4 1.11e-25 107 35 6 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9V1G3 1.31e-25 107 33 4 221 3 trpC Indole-3-glycerol phosphate synthase Pyrococcus abyssi (strain GE5 / Orsay)
Q8PJ26 2.04e-25 107 34 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas axonopodis pv. citri (strain 306)
Q3BRL1 2.17e-25 106 34 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5NPZ5 2.39e-25 106 35 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2RNS6 2.64e-25 106 35 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q87DS0 3.45e-25 106 35 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9J1 3.45e-25 106 35 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain M23)
B0U6K5 3.52e-25 106 35 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain M12)
A4WN19 4.18e-25 106 33 6 224 3 trpC Indole-3-glycerol phosphate synthase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
B1XNB2 4.68e-25 105 37 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q5V138 5.2e-25 107 34 4 235 3 trpC Indole-3-glycerol phosphate synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B2J1L6 5.25e-25 105 39 7 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q3SHL8 5.51e-25 105 36 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thiobacillus denitrificans (strain ATCC 25259)
Q3KF16 6.91e-25 104 35 6 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas fluorescens (strain Pf0-1)
Q5GXR3 8.29e-25 105 34 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SVN9 8.29e-25 105 34 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0U0 8.29e-25 105 34 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A0LA38 8.93e-25 104 37 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
P16923 1.73e-24 103 35 7 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Acinetobacter calcoaceticus
Q2LUD8 2.5e-24 103 38 7 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Syntrophus aciditrophicus (strain SB)
A1U0X4 3.53e-24 103 34 6 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8P7R6 3.82e-24 103 33 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RR82 3.82e-24 103 33 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas campestris pv. campestris (strain B100)
Q4UWD4 3.82e-24 103 33 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas campestris pv. campestris (strain 8004)
C3JZS5 3.92e-24 102 34 7 212 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas fluorescens (strain SBW25)
Q3MA33 5.5e-24 102 37 7 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8DGP3 6.3e-24 102 36 7 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q0AGX6 9.63e-24 101 35 8 202 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B1YBK5 1.03e-23 102 34 5 208 3 trpC Indole-3-glycerol phosphate synthase Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
B9M5M0 1.24e-23 101 36 5 196 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q8YLL0 1.35e-23 101 36 7 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1ICS3 2.34e-23 100 35 7 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas entomophila (strain L48)
Q9S3U4 3.31e-23 100 33 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)
B7JUH3 8.12e-23 99 34 7 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q9RUG0 8.73e-23 100 37 6 224 3 trpC Indole-3-glycerol phosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q82WI3 1.06e-22 99 33 6 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2Y7R3 3.05e-22 97 33 4 192 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5WX33 5.68e-22 97 32 5 196 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila (strain Lens)
B1WT19 9.59e-22 96 32 6 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q07UH2 1.51e-21 95 35 8 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rhodopseudomonas palustris (strain BisA53)
Q97EF4 1.85e-21 95 31 9 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A5GES5 3.19e-21 94 32 3 195 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geotalea uraniireducens (strain Rf4)
A5IBF6 3.56e-21 94 31 5 196 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila (strain Corby)
Q47HQ6 5.15e-21 94 36 6 191 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Dechloromonas aromatica (strain RCB)
B5EBV0 5.7e-21 94 32 3 198 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q5ZVY5 5.89e-21 94 31 5 196 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X5Q3 6.01e-21 94 31 5 196 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila (strain Paris)
Q9JVD1 8.34e-21 93 35 7 194 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A6V2W1 1.58e-20 92 37 7 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas aeruginosa (strain PA7)
Q1QY43 2.2e-20 92 37 9 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0K2U0 2.22e-20 92 31 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermoanaerobacter sp. (strain X514)
A2SHS5 2.26e-20 92 34 6 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0K8T5 3.62e-20 91 31 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q1CZH4 4.02e-20 91 37 7 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Myxococcus xanthus (strain DK1622)
Q8ESU3 4.42e-20 91 33 9 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q74AH7 5.69e-20 91 33 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1WY07 6.17e-20 91 32 8 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Halorhodospira halophila (strain DSM 244 / SL1)
A6L7N0 6.25e-20 90 32 7 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q56320 6.63e-20 90 32 9 206 1 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B3E754 7.68e-20 90 29 3 199 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B1XY47 8.1e-20 91 34 5 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A4IQ83 8.12e-20 91 33 7 213 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacillus thermodenitrificans (strain NG80-2)
C3MB98 9.08e-20 91 34 8 215 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B0KF94 1.15e-19 90 36 7 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain GB-1)
Q2N9N2 1.16e-19 90 35 7 197 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Erythrobacter litoralis (strain HTCC2594)
Q2SJD2 1.23e-19 90 29 7 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Hahella chejuensis (strain KCTC 2396)
B1LA13 1.42e-19 90 33 9 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermotoga sp. (strain RQ2)
A5IKT2 1.42e-19 90 33 9 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A4G4G1 1.88e-19 90 32 7 214 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Herminiimonas arsenicoxydans
Q8R9M8 1.98e-19 89 31 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5HWC0 2.38e-19 89 30 6 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Campylobacter jejuni (strain RM1221)
Q9PIF3 2.38e-19 89 30 6 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B1J538 2.45e-19 89 37 7 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain W619)
B3PFN8 2.64e-19 89 35 7 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Cellvibrio japonicus (strain Ueda107)
Q8XXX9 2.75e-19 89 31 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q59649 3.25e-19 89 35 6 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PS6 3.35e-19 89 35 6 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q13EQ3 3.56e-19 89 33 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rhodopseudomonas palustris (strain BisB5)
A1B8L1 3.72e-19 89 37 8 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Paracoccus denitrificans (strain Pd 1222)
Q4KEZ9 3.95e-19 89 35 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P13997 4.02e-19 89 33 9 215 3 TRP1 N-(5'-phosphoribosyl)anthranilate isomerase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
B7J4T0 4.1e-19 88 36 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q3JCB9 4.19e-19 88 31 6 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5E8A5 4.69e-19 89 35 9 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1ANJ2 4.83e-19 88 33 3 193 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9JXV5 5.25e-19 89 35 8 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q88LE0 5.61e-19 88 36 7 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B8J162 5.79e-19 88 39 10 194 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
C6DYM2 6.41e-19 88 31 3 198 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacter sp. (strain M21)
A5W6Y0 6.56e-19 88 36 7 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q39SQ9 7.75e-19 87 32 3 195 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q81GG6 7.9e-19 87 33 9 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12420
Feature type CDS
Gene trpF
Product bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
Location 138563 - 139930 (strand: -1)
Length 1368 (nucleotides) / 455 (amino acids)

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_947
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00218 Indole-3-glycerol phosphate synthase
PF00697 N-(5'phosphoribosyl)anthranilate (PRA) isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0134 Amino acid transport and metabolism (E) E Indole-3-glycerol phosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13498 indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24] Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Tryptophan biosynthesis, chorismate => tryptophan

Protein Sequence

MKGTVLEQIVNDKRISLVARKKQEPLLSFADNLPLSDRDFYQALRSAETAFILECKKASPSKGLIRQDFNLSEIAAAYALYATAVSVLTDEKYFQGQHDYLRQVRALITQPVLCKDFIIDAYQVYLARHYGADAILLMLSVLNDADYHSLATLAHSLNMGVLTEVSTEEELHRAIALDAQVIGINNRDLRDLSIDRRRTADFAPHIPADRIIISESGITTHQHIRELRPHADGFLIGSAIMAQPDLDTAIRRLIYGEHKVCGLTRADDARAAYDAGATFGGLIFVSKSPRYVDEAQAAEVMRGAPLAYVGVFRNHDPADIAAIARRLKLHAIQLHGDENEHDIALLRLHLPAKCEIWKALDMSHGADITVPDGVVRLVLDNGKGGTGQTFDWQTLPPSLPVPFTLAGGLNAENCVSAAASGAAGLDFNSGAESAPGIKDAEKLRQIFNQLHQQVA

Flanking regions ( +/- flanking 50bp)

GTGGTAACGCCTTTGAGCGCGTCACCGCCCTGGCCGCGAGAGGATAAACCATGAAAGGCACCGTATTAGAACAGATTGTGAATGATAAACGTATCTCCCTGGTCGCGCGGAAGAAACAGGAGCCGCTGCTGAGTTTTGCGGATAATCTGCCGCTGAGTGACCGCGATTTTTATCAGGCTCTGCGCAGCGCGGAAACCGCATTTATTCTGGAGTGCAAAAAAGCTTCTCCGTCGAAAGGACTTATCCGTCAGGATTTTAATCTCAGTGAAATCGCAGCGGCCTATGCGCTGTATGCCACAGCAGTCTCTGTACTGACCGACGAGAAATATTTTCAGGGACAACATGACTATCTGCGTCAGGTGCGCGCGCTGATCACTCAGCCGGTGTTATGCAAAGATTTCATTATTGATGCTTATCAGGTGTATCTCGCCCGCCACTATGGAGCAGACGCGATTCTGCTGATGCTCTCCGTCCTGAATGATGCTGATTATCACTCACTGGCGACCCTGGCTCATTCCCTCAATATGGGTGTGCTGACGGAAGTCAGTACGGAAGAAGAACTGCATCGCGCTATTGCCCTTGATGCACAGGTTATCGGTATCAATAACCGCGATCTGCGCGACCTCTCCATTGACCGCCGCCGGACAGCGGATTTTGCACCGCATATTCCGGCTGACCGCATTATTATCAGTGAATCCGGCATTACCACCCATCAGCACATCCGCGAATTGCGTCCCCATGCTGACGGATTCCTGATCGGCAGTGCCATTATGGCGCAGCCTGATCTGGACACAGCTATCCGCCGCCTGATTTACGGCGAACACAAAGTCTGCGGACTGACCCGTGCGGACGATGCCCGCGCCGCTTATGACGCCGGTGCCACCTTCGGCGGCCTGATTTTTGTCAGCAAATCGCCGCGTTATGTGGATGAAGCACAGGCAGCGGAGGTGATGCGCGGTGCACCGCTGGCGTACGTCGGTGTGTTCCGTAACCACGATCCCGCAGATATCGCTGCCATTGCCCGCCGCCTGAAACTGCATGCGATTCAGTTACATGGTGATGAAAACGAGCACGATATCGCGCTGCTGCGTCTGCACCTTCCGGCAAAATGTGAGATCTGGAAAGCACTGGATATGTCGCACGGTGCGGATATCACCGTGCCGGACGGCGTGGTGCGGCTGGTGCTGGATAACGGCAAAGGCGGCACCGGGCAGACTTTCGACTGGCAGACTCTGCCCCCTTCACTGCCGGTGCCCTTTACCCTGGCGGGCGGGCTGAATGCGGAAAACTGTGTCTCCGCCGCCGCCTCCGGTGCTGCCGGGCTGGATTTTAACTCCGGCGCCGAATCCGCCCCCGGTATTAAAGATGCAGAAAAACTTCGTCAGATATTTAATCAATTACATCAGCAAGTTGCCTGACTACGACTGAAAAGAAAAAGGATCAGAAAACAATGAGTAAATTAAATCCC