Homologs in group_1015

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05170 FBDBKF_05170 83.5 Morganella morganii S1 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
EHELCC_12420 EHELCC_12420 83.5 Morganella morganii S2 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
NLDBIP_12760 NLDBIP_12760 83.5 Morganella morganii S4 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
LHKJJB_12620 LHKJJB_12620 83.5 Morganella morganii S3 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
HKOGLL_11235 HKOGLL_11235 83.5 Morganella morganii S5 trpF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
PMI_RS06495 PMI_RS06495 58.1 Proteus mirabilis HI4320 trpCF bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF

Distribution of the homologs in the orthogroup group_1015

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1015

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KST5 0.0 531 58 2 450 3 trpCF Tryptophan biosynthesis protein TrpCF Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZEG8 0.0 525 58 2 454 3 trpC Tryptophan biosynthesis protein TrpCF Yersinia pestis
P00909 2.17e-177 507 56 0 453 1 trpC Tryptophan biosynthesis protein TrpCF Escherichia coli (strain K12)
Q8X7B7 2.82e-177 506 56 0 453 3 trpC Tryptophan biosynthesis protein TrpCF Escherichia coli O157:H7
P00910 7.35e-177 505 57 0 450 3 trpC Tryptophan biosynthesis protein TrpCF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7D9 5.48e-176 503 56 0 450 3 trpC Tryptophan biosynthesis protein TrpCF Salmonella typhi
P22098 8.72e-172 494 55 3 450 3 trpC Tryptophan biosynthesis protein TrpCF Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P46451 2.6e-161 467 52 4 464 3 trpC Tryptophan biosynthesis protein TrpCF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42393 4.4e-158 457 50 1 450 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57366 1.02e-156 454 50 2 452 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P57855 9.56e-156 452 51 5 464 3 trpC Tryptophan biosynthesis protein TrpCF Pasteurella multocida (strain Pm70)
O68427 5.25e-155 450 48 2 454 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Diuraphis noxia
P59459 1.68e-137 406 46 4 458 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q44603 4.18e-137 405 44 3 453 3 trpC Tryptophan biosynthesis protein TrpCF Buchnera aphidicola subsp. Schlechtendalia chinensis
O25867 3.1e-132 392 46 5 448 3 trpC Tryptophan biosynthesis protein TrpCF Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJU8 3.31e-129 384 47 6 449 3 trpC Tryptophan biosynthesis protein TrpCF Helicobacter pylori (strain J99 / ATCC 700824)
P06560 7.96e-98 305 40 8 466 1 trpC Tryptophan biosynthesis protein TrpCF Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q123F4 5.64e-59 197 43 5 260 3 trpC Indole-3-glycerol phosphate synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VTG7 4.38e-56 189 42 5 261 3 trpC Indole-3-glycerol phosphate synthase Polaromonas naphthalenivorans (strain CJ2)
B5ERI2 2.35e-54 185 44 4 259 3 trpC Indole-3-glycerol phosphate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBC0 2.35e-54 185 44 4 259 3 trpC Indole-3-glycerol phosphate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1TJQ2 3.72e-54 184 42 4 249 3 trpC Indole-3-glycerol phosphate synthase Paracidovorax citrulli (strain AAC00-1)
C5CKE4 5.33e-54 184 41 4 249 3 trpC Indole-3-glycerol phosphate synthase Variovorax paradoxus (strain S110)
P26938 3.22e-52 179 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Azospirillum brasilense
A9BS06 3.76e-52 179 40 5 253 3 trpC Indole-3-glycerol phosphate synthase Delftia acidovorans (strain DSM 14801 / SPH-1)
B9JX64 4.85e-52 179 41 4 260 3 trpC Indole-3-glycerol phosphate synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A5IG82 6.84e-52 178 41 5 256 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila (strain Corby)
Q5ZX99 7.52e-52 178 41 5 256 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X6S0 7.52e-52 178 41 5 256 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila (strain Paris)
Q5WY75 1.28e-51 178 41 5 256 3 trpC Indole-3-glycerol phosphate synthase Legionella pneumophila (strain Lens)
Q2G6R0 1.32e-51 178 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q21SE8 1.35e-51 178 40 4 257 3 trpC Indole-3-glycerol phosphate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9ZFA7 3.37e-51 177 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B9KMV0 3.66e-51 177 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B8EJS1 3.75e-51 177 40 4 261 3 trpC Indole-3-glycerol phosphate synthase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B5ZPY7 3.99e-51 177 43 3 233 3 trpC Indole-3-glycerol phosphate synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MGE1 5.96e-51 176 42 3 233 3 trpC Indole-3-glycerol phosphate synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A3PHK7 1.33e-50 176 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q7NUI6 2.6e-50 174 44 3 226 3 trpC Indole-3-glycerol phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4G1P4 2.85e-50 174 44 2 215 3 trpC Indole-3-glycerol phosphate synthase Herminiimonas arsenicoxydans
B4SLE8 3.16e-50 174 40 4 260 3 trpC Indole-3-glycerol phosphate synthase Stenotrophomonas maltophilia (strain R551-3)
Q9XBM3 4.02e-50 174 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)
Q8XVE6 4.92e-50 174 44 4 229 3 trpC1 Indole-3-glycerol phosphate synthase 1 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1W2Z8 6.23e-50 174 43 3 226 3 trpC Indole-3-glycerol phosphate synthase Acidovorax sp. (strain JS42)
P94327 6.76e-50 174 40 4 261 3 trpC Indole-3-glycerol phosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A3DDS7 7.36e-50 173 38 5 259 3 trpC Indole-3-glycerol phosphate synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2FKL1 7.43e-50 173 40 4 260 3 trpC Indole-3-glycerol phosphate synthase Stenotrophomonas maltophilia (strain K279a)
Q46WU7 9.68e-50 173 41 2 220 3 trpC Indole-3-glycerol phosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q98ME3 9.78e-50 173 40 4 261 3 trpC Indole-3-glycerol phosphate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q7VU67 1.04e-49 173 46 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A5FPM3 1.11e-49 172 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q7W387 1.14e-49 173 46 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WEK6 1.14e-49 173 46 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5NQ36 1.41e-49 172 40 5 260 3 trpC Indole-3-glycerol phosphate synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q92370 1.43e-49 183 31 17 506 2 trp1 Multifunctional tryptophan biosynthesis protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2UDK9 1.52e-49 172 43 2 219 3 trpC Indole-3-glycerol phosphate synthase Ralstonia pickettii (strain 12J)
A8I836 1.54e-49 172 42 2 228 3 trpC Indole-3-glycerol phosphate synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A2BSL8 1.82e-49 173 40 6 262 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain AS9601)
Q3ZZ14 2.01e-49 172 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Dehalococcoides mccartyi (strain CBDB1)
Q319J2 2.04e-49 173 40 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9312)
B9MBS5 2.38e-49 172 43 3 227 3 trpC Indole-3-glycerol phosphate synthase Acidovorax ebreus (strain TPSY)
B9JFD8 2.83e-49 172 42 3 230 3 trpC Indole-3-glycerol phosphate synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
C3MCF2 3.31e-49 172 44 3 229 3 trpC Indole-3-glycerol phosphate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q3Z6G5 3.64e-49 171 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B1XSZ1 4.37e-49 171 39 4 264 3 trpC Indole-3-glycerol phosphate synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q97EF3 4.64e-49 171 41 4 246 3 trpC Indole-3-glycerol phosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A9HY11 5.73e-49 171 44 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q3K5V4 6.34e-49 171 40 6 267 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas fluorescens (strain Pf0-1)
A6X0L0 8.9e-49 171 42 3 230 3 trpC Indole-3-glycerol phosphate synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9BBR3 9.3e-49 171 40 7 262 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9211)
Q87EX2 1.04e-48 170 43 3 227 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6S5 1.04e-48 170 43 3 227 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain M23)
B1JE34 1.1e-48 171 40 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain W619)
B3R703 1.2e-48 170 41 3 222 3 trpC Indole-3-glycerol phosphate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K6I0 1.44e-48 170 40 2 220 3 trpC Indole-3-glycerol phosphate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O67657 1.47e-48 170 46 4 207 3 trpC Indole-3-glycerol phosphate synthase Aquifex aeolicus (strain VF5)
B1Y7I2 2.05e-48 169 38 4 249 3 trpC Indole-3-glycerol phosphate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A7HXZ6 2.38e-48 169 40 4 258 3 trpC Indole-3-glycerol phosphate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5VXL5 2.99e-48 169 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C1DHY7 3.43e-48 169 40 5 261 3 trpC Indole-3-glycerol phosphate synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A8ET36 3.54e-48 169 41 5 248 3 trpC Indole-3-glycerol phosphate synthase Aliarcobacter butzleri (strain RM4018)
A3PED0 3.57e-48 170 39 6 262 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9301)
P20578 4.02e-48 169 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida
Q9PGT5 4.13e-48 169 43 3 227 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain 9a5c)
Q88A03 4.31e-48 169 41 6 266 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88QR6 4.37e-48 169 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P24920 4.84e-48 176 29 19 541 3 TRP1 Tryptophan biosynthesis protein TRP1 Phytophthora nicotianae
B0U1P0 5.32e-48 168 43 3 227 3 trpC Indole-3-glycerol phosphate synthase Xylella fastidiosa (strain M12)
A8Z6K1 5.72e-48 168 37 3 260 3 trpC Indole-3-glycerol phosphate synthase Campylobacter concisus (strain 13826)
A4VHK1 7.22e-48 169 40 5 267 3 trpC Indole-3-glycerol phosphate synthase Stutzerimonas stutzeri (strain A1501)
Q8PQ47 7.27e-48 168 43 2 207 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
A1WH73 8.27e-48 168 43 4 228 3 trpC Indole-3-glycerol phosphate synthase Verminephrobacter eiseniae (strain EF01-2)
Q1IFZ9 8.82e-48 168 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas entomophila (strain L48)
Q2IWB0 9.45e-48 168 41 5 250 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain HaA2)
Q5P2G1 9.96e-48 167 39 5 260 3 trpC Indole-3-glycerol phosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1KAT2 1.36e-47 167 41 6 262 3 trpC Indole-3-glycerol phosphate synthase Azoarcus sp. (strain BH72)
Q10ZM7 1.39e-47 168 38 7 268 3 trpC Indole-3-glycerol phosphate synthase Trichodesmium erythraeum (strain IMS101)
A8G6A7 1.4e-47 168 38 7 266 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9215)
A2BY04 1.51e-47 168 39 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9515)
Q4K503 1.71e-47 167 39 6 267 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1D7J7 1.89e-47 167 41 5 250 3 trpC Indole-3-glycerol phosphate synthase Laribacter hongkongensis (strain HLHK9)
A6SUH5 1.95e-47 167 38 4 262 3 trpC Indole-3-glycerol phosphate synthase Janthinobacterium sp. (strain Marseille)
Q2NYD7 1.98e-47 167 44 2 207 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SL03 2.1e-47 167 44 2 207 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q11HU1 2.17e-47 167 43 3 223 3 trpC Indole-3-glycerol phosphate synthase Chelativorans sp. (strain BNC1)
Q3BYB5 2.19e-47 167 43 2 207 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2K879 2.83e-47 167 42 3 233 3 trpC Indole-3-glycerol phosphate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A5VBA0 4.27e-47 166 39 4 259 3 trpC Indole-3-glycerol phosphate synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B2IKL7 5.32e-47 166 43 3 223 3 trpC Indole-3-glycerol phosphate synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q2RT48 5.58e-47 166 40 5 259 3 trpC Indole-3-glycerol phosphate synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3SGS2 6.56e-47 166 40 4 257 3 trpC Indole-3-glycerol phosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
B7V609 7.14e-47 166 40 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain LESB58)
Q8XS01 7.35e-47 166 42 3 234 3 trpC2 Indole-3-glycerol phosphate synthase 2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P20577 8.19e-47 166 40 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TB5 8.9e-47 166 40 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
C3K307 9.29e-47 166 39 6 268 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas fluorescens (strain SBW25)
B3Q0L3 9.59e-47 165 42 3 235 3 trpC Indole-3-glycerol phosphate synthase Rhizobium etli (strain CIAT 652)
B3Q6M9 1.09e-46 165 40 4 250 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain TIE-1)
B0CGT9 1.17e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
B0SYZ4 1.21e-46 165 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Caulobacter sp. (strain K31)
P66989 1.24e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella suis biovar 1 (strain 1330)
P66988 1.24e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJB1 1.24e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5F4 1.24e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CZ8 1.24e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella abortus biovar 1 (strain 9-941)
Q2YRR4 1.24e-46 165 40 3 233 1 trpC Indole-3-glycerol phosphate synthase Brucella abortus (strain 2308)
B2S5Z1 1.24e-46 165 40 3 233 3 trpC Indole-3-glycerol phosphate synthase Brucella abortus (strain S19)
A6UZF2 1.4e-46 165 40 6 265 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas aeruginosa (strain PA7)
B4RBX5 1.53e-46 164 39 5 259 3 trpC Indole-3-glycerol phosphate synthase Phenylobacterium zucineum (strain HLK1)
Q47AC7 1.76e-46 164 42 4 245 3 trpC Indole-3-glycerol phosphate synthase Dechloromonas aromatica (strain RCB)
B2JHI8 1.94e-46 164 37 4 260 3 trpC Indole-3-glycerol phosphate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q7M831 2e-46 164 40 4 254 3 trpC Indole-3-glycerol phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5KXU9 2.01e-46 164 41 6 259 3 trpC Indole-3-glycerol phosphate synthase Geobacillus kaustophilus (strain HTA426)
A4SV52 2.11e-46 164 40 4 249 3 trpC Indole-3-glycerol phosphate synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4WX67 3.31e-46 164 44 2 205 3 trpC Indole-3-glycerol phosphate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q7VAT3 3.36e-46 164 40 8 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A4IQ84 4.46e-46 163 41 6 258 3 trpC Indole-3-glycerol phosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
A4SG41 4.85e-46 163 40 4 247 3 trpC Indole-3-glycerol phosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A5VQR5 6.08e-46 163 38 5 272 3 trpC Indole-3-glycerol phosphate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A5GRL0 6.08e-46 164 39 7 264 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain RCC307)
Q136D2 6.21e-46 163 45 2 205 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain BisB5)
B0KK35 6.57e-46 163 39 5 264 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas putida (strain GB-1)
Q7TU64 7e-46 164 38 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q92PR9 7.25e-46 163 39 4 264 3 trpC Indole-3-glycerol phosphate synthase Rhizobium meliloti (strain 1021)
Q30SM1 8.31e-46 162 37 4 262 3 trpC Indole-3-glycerol phosphate synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A5USQ4 1.12e-45 162 38 6 263 3 trpC Indole-3-glycerol phosphate synthase Roseiflexus sp. (strain RS-1)
B1GZC0 1.33e-45 162 40 3 234 3 trpC Indole-3-glycerol phosphate synthase Endomicrobium trichonymphae
Q48NP7 1.99e-45 162 40 6 269 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B8GWP9 1.99e-45 162 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A727 1.99e-45 162 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8PD70 2.08e-45 162 42 2 207 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UZF8 2.08e-45 162 42 2 207 3 trpC Indole-3-glycerol phosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
A8FEK0 4.53e-45 160 38 6 248 3 trpC Indole-3-glycerol phosphate synthase Bacillus pumilus (strain SAFR-032)
B1WQE4 4.88e-45 161 40 8 268 3 trpC Indole-3-glycerol phosphate synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
C4Z138 5.01e-45 160 38 3 246 3 trpC Indole-3-glycerol phosphate synthase Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
A9KL43 5.91e-45 160 37 3 220 3 trpC Indole-3-glycerol phosphate synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
P20409 6.14e-45 170 30 18 536 3 trp1 Multifunctional tryptophan biosynthesis protein Phycomyces blakesleeanus
Q3ABS1 6.27e-45 160 39 6 252 3 trpC Indole-3-glycerol phosphate synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3AU73 7.46e-45 160 39 7 253 3 trpC Indole-3-glycerol phosphate synthase Chlorobium chlorochromatii (strain CaD3)
A7GYQ7 1.24e-44 159 37 4 260 3 trpC Indole-3-glycerol phosphate synthase Campylobacter curvus (strain 525.92)
Q55508 1.49e-44 160 39 8 265 3 trpC Indole-3-glycerol phosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9K192 1.55e-44 159 40 4 232 3 trpC Indole-3-glycerol phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JSN4 2.85e-44 158 43 3 205 3 trpC Indole-3-glycerol phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A0RNN3 3.16e-44 158 37 4 254 3 trpC Indole-3-glycerol phosphate synthase Campylobacter fetus subsp. fetus (strain 82-40)
A5N7N8 4.26e-44 158 37 4 245 3 trpC Indole-3-glycerol phosphate synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E149 4.26e-44 158 37 4 245 3 trpC Indole-3-glycerol phosphate synthase Clostridium kluyveri (strain NBRC 12016)
A7NMZ8 4.74e-44 158 38 7 264 3 trpC Indole-3-glycerol phosphate synthase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q7UKJ7 4.94e-44 158 39 3 223 3 trpC Indole-3-glycerol phosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q215B9 6.68e-44 158 44 2 215 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain BisB18)
A6U9C5 7.29e-44 158 38 4 264 3 trpC Indole-3-glycerol phosphate synthase Sinorhizobium medicae (strain WSM419)
A1KRV4 8.14e-44 157 42 3 205 3 trpC Indole-3-glycerol phosphate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5F645 1.64e-43 156 40 4 232 3 trpC Indole-3-glycerol phosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P00911 1.71e-43 157 37 5 265 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A6Q3P0 2.14e-43 156 37 4 257 3 trpC Indole-3-glycerol phosphate synthase Nitratiruptor sp. (strain SB155-2)
B0CEU2 2.21e-43 157 38 7 255 3 trpC Indole-3-glycerol phosphate synthase Acaryochloris marina (strain MBIC 11017)
B0VUS0 2.94e-43 156 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain SDF)
Q3B2C7 3.28e-43 155 39 6 252 3 trpC Indole-3-glycerol phosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q3AV87 3.65e-43 157 38 7 263 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain CC9902)
B4RPF1 3.75e-43 155 40 4 232 3 trpC Indole-3-glycerol phosphate synthase Neisseria gonorrhoeae (strain NCCP11945)
B0VBS1 3.86e-43 155 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain AYE)
A3M785 3.86e-43 155 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7I441 3.86e-43 155 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain AB0057)
B2HVE7 4.15e-43 155 38 5 262 3 trpC Indole-3-glycerol phosphate synthase Acinetobacter baumannii (strain ACICU)
A1BDW1 4.96e-43 155 39 6 261 3 trpC Indole-3-glycerol phosphate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q5N575 8.27e-43 155 42 5 228 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q8KPR4 8.27e-43 155 42 5 228 3 trpC Indole-3-glycerol phosphate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q3SRJ3 8.97e-43 155 38 4 265 3 trpC Indole-3-glycerol phosphate synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3AL94 9.08e-43 155 37 7 262 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain CC9605)
A4XZC5 9.38e-43 155 39 7 266 3 trpC Indole-3-glycerol phosphate synthase Pseudomonas mendocina (strain ymp)
A7Z618 9.9e-43 154 39 6 248 3 trpC Indole-3-glycerol phosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q7CYR2 1.42e-42 154 41 3 229 3 trpC Indole-3-glycerol phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
B8HP79 1.47e-42 155 38 6 253 3 trpC Indole-3-glycerol phosphate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A4JB67 1.58e-42 154 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B6JG29 2.29e-42 154 41 4 258 3 trpC Indole-3-glycerol phosphate synthase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B0K8T4 2.57e-42 153 39 3 205 3 trpC Indole-3-glycerol phosphate synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B4SDV8 4.63e-42 152 39 5 250 3 trpC Indole-3-glycerol phosphate synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A7INK2 5.1e-42 152 42 2 214 3 trpC Indole-3-glycerol phosphate synthase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q7TTU3 5.77e-42 153 37 6 265 3 trpC Indole-3-glycerol phosphate synthase Parasynechococcus marenigrum (strain WH8102)
B3QZD6 8.01e-42 152 39 4 251 3 trpC Indole-3-glycerol phosphate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B0K2U1 8.61e-42 152 39 3 205 3 trpC Indole-3-glycerol phosphate synthase Thermoanaerobacter sp. (strain X514)
Q1QMJ9 9.59e-42 152 40 5 259 3 trpC Indole-3-glycerol phosphate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q7NHI0 1.04e-41 153 37 7 269 3 trpC Indole-3-glycerol phosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B7K0H0 1.09e-41 152 39 8 264 3 trpC Indole-3-glycerol phosphate synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q5HVR3 1.18e-41 151 37 5 257 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni (strain RM1221)
Q9PI11 1.18e-41 151 37 5 257 1 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKS2 1.18e-41 151 37 5 257 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q8AAD6 1.2e-41 151 37 4 241 3 trpC Indole-3-glycerol phosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A7H4P0 1.25e-41 151 37 5 257 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q2KU99 1.6e-41 151 41 3 223 3 trpC Indole-3-glycerol phosphate synthase Bordetella avium (strain 197N)
A4T9N5 2.54e-41 151 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium gilvum (strain PYR-GCK)
Q1BSD2 3.69e-41 150 41 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia orbicola (strain AU 1054)
B1JUU5 3.69e-41 150 41 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia orbicola (strain MC0-3)
A0K458 3.69e-41 150 41 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia cenocepacia (strain HI2424)
B3W6W8 3.91e-41 150 37 3 243 3 trpC Indole-3-glycerol phosphate synthase Lacticaseibacillus casei (strain BL23)
A4J147 4.19e-41 150 39 4 224 3 trpC Indole-3-glycerol phosphate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A1T8X3 4.55e-41 150 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A1VYK3 5.45e-41 150 36 5 257 3 trpC Indole-3-glycerol phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A6TM74 6.35e-41 150 40 3 222 3 trpC Indole-3-glycerol phosphate synthase Alkaliphilus metalliredigens (strain QYMF)
Q0BIM8 7.04e-41 149 40 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q03CY1 7.23e-41 149 37 3 243 3 trpC Indole-3-glycerol phosphate synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q39JZ7 1.29e-40 149 40 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P70937 1.35e-40 149 39 6 248 3 trpC Indole-3-glycerol phosphate synthase Priestia megaterium (strain ATCC 12872 / QMB1551)
Q9KCB2 1.65e-40 148 37 7 258 3 trpC Indole-3-glycerol phosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O68814 1.96e-40 149 36 5 261 3 trpC1 Indole-3-glycerol phosphate synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A1R5S7 2.05e-40 149 41 2 195 3 trpC Indole-3-glycerol phosphate synthase Paenarthrobacter aurescens (strain TC1)
B1YSF5 2.06e-40 148 40 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia ambifaria (strain MC40-6)
B1MBV4 2.08e-40 149 37 5 268 3 trpC Indole-3-glycerol phosphate synthase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A9AJ43 2.17e-40 148 40 4 244 3 trpC Indole-3-glycerol phosphate synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q03X00 2.23e-40 148 38 3 218 3 trpC Indole-3-glycerol phosphate synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B2SZ04 3.12e-40 148 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q2SUI0 3.57e-40 147 40 5 260 3 trpC Indole-3-glycerol phosphate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4YVD6 3.95e-40 148 42 3 223 3 trpC Indole-3-glycerol phosphate synthase Bradyrhizobium sp. (strain ORS 278)
B9LAF4 4.42e-40 147 35 4 254 3 trpC Indole-3-glycerol phosphate synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A3NDZ3 5.14e-40 147 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain 668)
P24773 5.23e-40 156 29 15 488 3 trpC Multifunctional tryptophan biosynthesis protein Penicillium chrysogenum
Q3JNB0 5.59e-40 147 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain 1710b)
A2CB59 5.85e-40 148 38 7 266 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9303)
B3EG28 6.29e-40 147 36 4 249 3 trpC Indole-3-glycerol phosphate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A5EVG3 6.54e-40 147 34 3 249 3 trpC Indole-3-glycerol phosphate synthase Dichelobacter nodosus (strain VCS1703A)
Q63QH0 8.65e-40 147 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain K96243)
A3NZP6 8.65e-40 147 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia pseudomallei (strain 1106a)
P17217 1.1e-39 146 36 3 243 3 trpC Indole-3-glycerol phosphate synthase Lacticaseibacillus casei
C1AT55 1.52e-39 146 40 3 213 3 trpC Indole-3-glycerol phosphate synthase Rhodococcus opacus (strain B4)
A7I2Y2 1.68e-39 146 37 6 262 3 trpC Indole-3-glycerol phosphate synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q13TW4 2.23e-39 145 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Paraburkholderia xenovorans (strain LB400)
Q07NF6 2.42e-39 146 38 5 259 3 trpC Indole-3-glycerol phosphate synthase Rhodopseudomonas palustris (strain BisA53)
Q0SHZ5 2.45e-39 145 40 3 213 3 trpC Indole-3-glycerol phosphate synthase Rhodococcus jostii (strain RHA1)
A0QX95 2.59e-39 145 36 4 263 1 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1UWA0 3.7e-39 145 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain SAVP1)
Q62DD0 3.7e-39 145 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain ATCC 23344)
A2RYI3 3.7e-39 145 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain NCTC 10229)
A3MFQ4 3.7e-39 145 39 4 258 3 trpC Indole-3-glycerol phosphate synthase Burkholderia mallei (strain NCTC 10247)
P49572 4.3e-39 149 37 10 272 1 IGPS Indole-3-glycerol phosphate synthase, chloroplastic Arabidopsis thaliana
P06531 5.57e-39 153 29 17 521 2 trpC Multifunctional tryptophan biosynthesis protein Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7TV44 6.45e-39 145 37 7 266 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain MIT 9313)
B8I0V0 1.11e-38 144 35 4 248 3 trpC Indole-3-glycerol phosphate synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
C5CBK6 1.19e-38 144 35 4 257 3 trpC Indole-3-glycerol phosphate synthase Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
C5D3D6 1.76e-38 143 36 6 263 3 trpC Indole-3-glycerol phosphate synthase Geobacillus sp. (strain WCH70)
Q6AMS4 1.84e-38 143 40 3 217 3 trpC Indole-3-glycerol phosphate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q1B7H6 3.53e-38 142 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium sp. (strain MCS)
A1UHJ6 3.53e-38 142 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium sp. (strain KMS)
A3Q119 3.53e-38 142 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium sp. (strain JLS)
P03964 3.8e-38 142 39 7 245 3 trpC Indole-3-glycerol phosphate synthase Bacillus subtilis (strain 168)
Q1ISJ1 4.08e-38 142 38 6 262 3 trpC Indole-3-glycerol phosphate synthase Koribacter versatilis (strain Ellin345)
B3QLY7 4.67e-38 142 34 4 249 3 trpC Indole-3-glycerol phosphate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A9BHQ5 4.94e-38 142 35 5 247 3 trpC Indole-3-glycerol phosphate synthase Petrotoga mobilis (strain DSM 10674 / SJ95)
A5EK25 5.06e-38 142 42 2 205 3 trpC Indole-3-glycerol phosphate synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8KBW1 6.78e-38 141 35 4 249 3 trpC Indole-3-glycerol phosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q2S1Z5 7.59e-38 142 35 6 262 3 trpC Indole-3-glycerol phosphate synthase Salinibacter ruber (strain DSM 13855 / M31)
Q740P4 1.19e-37 141 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QHH0 1.19e-37 141 36 5 266 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium avium (strain 104)
Q8R9M7 1.37e-37 140 40 3 205 3 trpC Indole-3-glycerol phosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C4KZ66 1.51e-37 140 39 5 218 3 trpC Indole-3-glycerol phosphate synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
P9WFX7 1.73e-37 141 36 4 263 1 trpC Indole-3-glycerol phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U2W7 1.73e-37 141 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1ANN3 1.73e-37 141 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJ27 1.73e-37 141 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A633 1.73e-37 141 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q88WI2 1.83e-37 140 36 5 249 3 trpC Indole-3-glycerol phosphate synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q02584 2.37e-37 140 38 7 263 3 trpC Indole-3-glycerol phosphate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
B1I7S9 2.7e-37 140 40 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain Hungary19A-6)
B1W0N8 3.79e-37 140 35 3 255 3 trpC Indole-3-glycerol phosphate synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B2HQX7 4.77e-37 139 38 3 226 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
P9WFX6 4.87e-37 139 36 4 263 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B0JTM2 5.68e-37 140 37 7 236 3 trpC Indole-3-glycerol phosphate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
P0CN87 7.92e-37 147 29 17 493 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P00937 8.09e-37 144 36 6 268 1 TRP3 Multifunctional tryptophan biosynthesis protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0AJ82 9.1e-37 138 36 4 252 3 trpC Indole-3-glycerol phosphate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A0JVL1 9.62e-37 139 38 2 195 3 trpC Indole-3-glycerol phosphate synthase Arthrobacter sp. (strain FB24)
Q8F7V2 9.88e-37 138 34 2 243 3 trpC Indole-3-glycerol phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NP6 9.88e-37 138 34 2 243 3 trpC Indole-3-glycerol phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A2C462 1.04e-36 139 36 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain NATL1A)
Q0C1A2 1.12e-36 138 39 4 248 3 trpC Indole-3-glycerol phosphate synthase Hyphomonas neptunium (strain ATCC 15444)
P0CN86 1.45e-36 146 29 17 493 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q0IC57 2.11e-36 139 39 7 265 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain CC9311)
A1SL44 2.21e-36 137 35 3 254 3 trpC Indole-3-glycerol phosphate synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q82A84 2.28e-36 138 35 3 255 3 trpC Indole-3-glycerol phosphate synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q46JH4 2.52e-36 138 36 7 263 3 trpC Indole-3-glycerol phosphate synthase Prochlorococcus marinus (strain NATL2A)
Q8TVJ8 2.61e-36 137 34 4 241 3 trpC Indole-3-glycerol phosphate synthase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A6WC91 2.8e-36 137 33 5 278 3 trpC Indole-3-glycerol phosphate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q56319 4.7e-36 136 35 3 230 1 trpC Indole-3-glycerol phosphate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q65I33 5.1e-36 136 37 6 247 3 trpC Indole-3-glycerol phosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8AW03 5.57e-36 136 36 3 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8Y6Q4 5.66e-36 136 35 5 253 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9X7C7 7.87e-36 136 38 3 213 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium leprae (strain TN)
B8ZRB9 7.87e-36 136 38 3 213 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium leprae (strain Br4923)
Q71Z38 9.57e-36 135 36 4 252 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
C1KVS7 9.57e-36 135 36 4 252 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
A0PP28 1.04e-35 136 37 3 226 3 trpC Indole-3-glycerol phosphate synthase Mycobacterium ulcerans (strain Agy99)
B8DHB2 1.12e-35 135 35 5 253 3 trpC Indole-3-glycerol phosphate synthase Listeria monocytogenes serotype 4a (strain HCC23)
B1YLS2 1.19e-35 135 39 5 240 3 trpC Indole-3-glycerol phosphate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q0RFX9 1.9e-35 135 38 2 218 3 trpC Indole-3-glycerol phosphate synthase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
P25170 2e-35 143 29 16 528 3 TRPC Multifunctional tryptophan biosynthesis protein Phanerodontia chrysosporium
C1CT53 2.02e-35 135 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CMD5 2.19e-35 135 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain P1031)
B2ISS3 2.19e-35 135 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain CGSP14)
Q97P30 2.19e-35 135 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZN61 2.19e-35 135 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B5E7M5 2.19e-35 135 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae serotype 19F (strain G54)
C1CG44 3.02e-35 134 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain JJA)
Q8DNM6 3.02e-35 134 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04IY7 3.02e-35 134 39 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8CPB2 3.02e-35 134 36 6 247 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
O27694 3.03e-35 135 36 5 241 3 trpC Indole-3-glycerol phosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A8LGR8 6.05e-35 134 34 4 247 3 trpC Indole-3-glycerol phosphate synthase Parafrankia sp. (strain EAN1pec)
Q5HPH2 6.95e-35 134 36 6 247 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q06121 1.58e-34 132 38 3 194 1 trpC Indole-3-glycerol phosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q92B79 1.99e-34 132 36 4 241 3 trpC Indole-3-glycerol phosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P27710 2.11e-34 139 28 16 493 3 TRP1 Multifunctional tryptophan biosynthesis protein Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
P26939 2.23e-34 132 33 5 245 3 trpC Indole-3-glycerol phosphate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q5LYI5 2.29e-34 132 35 3 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus thermophilus (strain CNRZ 1066)
Q47QR5 2.91e-34 132 38 3 242 3 trpC Indole-3-glycerol phosphate synthase Thermobifida fusca (strain YX)
Q03JB9 2.96e-34 132 35 3 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
C1C968 3.49e-34 131 38 1 203 3 trpC Indole-3-glycerol phosphate synthase Streptococcus pneumoniae (strain 70585)
A0LA39 3.8e-34 132 35 6 264 3 trpC Indole-3-glycerol phosphate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A4FLL0 4.68e-34 131 35 4 263 3 trpC Indole-3-glycerol phosphate synthase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
P00908 4.86e-34 139 31 16 460 3 trp-1 Multifunctional tryptophan biosynthesis protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q5WGS3 5.59e-34 131 40 3 202 3 trpC Indole-3-glycerol phosphate synthase Shouchella clausii (strain KSM-K16)
Q5M348 7.84e-34 130 35 3 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
A3CLL9 1.48e-33 130 34 3 243 3 trpC Indole-3-glycerol phosphate synthase Streptococcus sanguinis (strain SK36)
Q49XH6 2.58e-33 129 36 4 247 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8DVF5 5.22e-33 128 38 2 195 3 trpC Indole-3-glycerol phosphate synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A5GMK4 2.22e-32 127 38 7 263 3 trpC Indole-3-glycerol phosphate synthase Synechococcus sp. (strain WH7803)
Q01999 3.76e-32 126 35 5 257 3 trpC Indole-3-glycerol phosphate synthase Lactococcus lactis subsp. lactis (strain IL1403)
A8ZZX0 4.64e-32 126 34 4 230 3 trpC Indole-3-glycerol phosphate synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q8ESU2 7.75e-32 125 35 7 263 3 trpC Indole-3-glycerol phosphate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A9VJW0 8.25e-32 125 33 6 250 3 trpC Indole-3-glycerol phosphate synthase Bacillus mycoides (strain KBAB4)
Q6GH35 9.77e-32 125 35 4 241 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain MRSA252)
Q58328 9.77e-32 125 36 4 208 3 trpC Indole-3-glycerol phosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P18483 1.49e-31 131 29 13 488 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus awamori
Q2JPT2 2.52e-31 123 39 6 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q6AF68 2.73e-31 124 37 4 215 3 trpC Indole-3-glycerol phosphate synthase Leifsonia xyli subsp. xyli (strain CTCB07)
B7JES8 4e-31 123 34 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain AH820)
Q81TM0 4e-31 123 34 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus anthracis
C3LAW0 4e-31 123 34 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3T8 4e-31 123 34 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus anthracis (strain A0248)
Q4L677 4.68e-31 123 32 4 253 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus haemolyticus (strain JCSC1435)
A6QGS2 5.34e-31 123 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain Newman)
Q9RL78 5.34e-31 123 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain COL)
Q8NWU3 8.62e-31 122 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain MW2)
A8Z242 8.62e-31 122 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9I9 8.62e-31 122 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain MSSA476)
Q2FYR6 8.62e-31 122 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH66 8.62e-31 122 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain USA300)
Q02YB4 1.72e-30 122 38 6 211 3 trpC Indole-3-glycerol phosphate synthase Lactococcus lactis subsp. cremoris (strain SK11)
A2RK21 1.72e-30 122 38 6 211 3 trpC Indole-3-glycerol phosphate synthase Lactococcus lactis subsp. cremoris (strain MG1363)
Q2YXU9 1.92e-30 121 34 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B7IM74 2.1e-30 121 33 7 250 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain G9842)
Q6HLU6 2.12e-30 121 33 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IU36 3.28e-30 120 33 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain Q1)
B7I0F0 3.28e-30 120 33 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain AH187)
Q63EC9 3.49e-30 120 33 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain ZK / E33L)
P66991 3.6e-30 120 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain N315)
P66990 3.6e-30 120 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISQ2 3.6e-30 120 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain JH9)
A6U1J2 3.6e-30 120 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain JH1)
A7X234 3.6e-30 120 35 6 242 3 trpC Indole-3-glycerol phosphate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
P05328 4.77e-30 127 29 13 488 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus niger
Q9Z4X0 5.21e-30 120 38 2 222 3 trpC2 Indole-3-glycerol phosphate synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B1ZW79 7.53e-30 120 35 6 255 3 trpC Indole-3-glycerol phosphate synthase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
B7HGZ9 8.68e-30 119 32 6 250 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain B4264)
C1ELE8 2.54e-29 118 33 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain 03BB102)
A0RB62 2.54e-29 118 33 6 252 3 trpC Indole-3-glycerol phosphate synthase Bacillus thuringiensis (strain Al Hakam)
B0JNJ4 4.2e-29 116 37 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q81GG7 4.75e-29 117 32 4 247 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9HSC1 4.77e-29 117 37 5 204 3 trpC Indole-3-glycerol phosphate synthase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9YGB5 4.81e-29 117 34 3 214 3 trpC Indole-3-glycerol phosphate synthase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q4J8X3 1.09e-28 116 37 2 191 3 trpC Indole-3-glycerol phosphate synthase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
B7KC08 2.83e-28 114 37 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Gloeothece citriformis (strain PCC 7424)
B0CA72 2.9e-28 114 35 7 214 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Acaryochloris marina (strain MBIC 11017)
C5BV85 3.02e-28 115 32 4 256 3 trpC Indole-3-glycerol phosphate synthase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q9V1G3 4.07e-28 114 35 4 219 3 trpC Indole-3-glycerol phosphate synthase Pyrococcus abyssi (strain GE5 / Orsay)
Q972A1 1.14e-27 113 36 4 196 3 trpC Indole-3-glycerol phosphate synthase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
A4YHD8 1.61e-27 113 30 4 251 3 trpC Indole-3-glycerol phosphate synthase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q3MA33 2.19e-27 112 39 7 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B1XNB2 2.95e-27 111 38 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B2J1L6 4.17e-27 111 40 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q8U088 5.63e-27 111 34 3 201 3 trpC Indole-3-glycerol phosphate synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P18304 6.19e-27 112 34 6 210 3 trpC Indole-3-glycerol phosphate synthase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A0LJ58 9.7e-27 111 32 5 243 3 trpC Indole-3-glycerol phosphate synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q92411 1.34e-26 116 27 17 516 3 TRP1 Multifunctional tryptophan biosynthesis protein Cochliobolus heterostrophus
Q8YLL0 1.93e-26 109 38 7 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2JW90 3.77e-26 108 39 7 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus sp. (strain JA-3-3Ab)
Q5V138 1.69e-25 108 35 6 236 3 trpC Indole-3-glycerol phosphate synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q73BQ9 3.45e-25 107 34 8 264 3 trpC Indole-3-glycerol phosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A4WN19 7.68e-25 105 34 5 205 3 trpC Indole-3-glycerol phosphate synthase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
Q28LA8 1.55e-24 104 37 7 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Jannaschia sp. (strain CCS1)
Q2W020 2.52e-24 103 35 8 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P16923 1.17e-23 101 33 8 210 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Acinetobacter calcoaceticus
Q10XS2 1.88e-23 101 31 5 220 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Trichodesmium erythraeum (strain IMS101)
Q8ZYX2 2.33e-23 102 34 5 205 3 trpC Indole-3-glycerol phosphate synthase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
B1YBK5 4.21e-23 101 34 4 192 3 trpC Indole-3-glycerol phosphate synthase Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
Q5NPZ5 5.23e-23 99 33 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8PJ26 7.9e-23 99 34 8 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas axonopodis pv. citri (strain 306)
Q3BRL1 9.34e-23 99 34 8 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8DGP3 1.4e-22 99 34 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9RUG0 1.5e-22 100 36 5 218 3 trpC Indole-3-glycerol phosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C1DQD4 1.61e-22 98 32 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q31R79 1.9e-22 98 36 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5N322 2.12e-22 98 36 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q82WI3 2.46e-22 97 33 6 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A0LA38 3.33e-22 97 36 7 200 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C3JZS5 3.82e-22 97 33 6 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas fluorescens (strain SBW25)
Q9PDK5 5.24e-22 97 33 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain 9a5c)
Q5WX33 5.35e-22 97 31 4 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila (strain Lens)
B8J162 5.93e-22 97 40 8 192 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B0U6K5 8.85e-22 96 33 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain M12)
Q5GXR3 9.07e-22 96 34 8 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SVN9 9.07e-22 96 34 8 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0U0 9.07e-22 96 34 8 211 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B7JUH3 9.08e-22 96 33 7 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q87DS0 1.12e-21 96 33 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9J1 1.12e-21 96 33 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xylella fastidiosa (strain M23)
Q8P7R6 1.88e-21 95 33 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RR82 1.88e-21 95 33 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas campestris pv. campestris (strain B100)
Q4UWD4 1.88e-21 95 33 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Xanthomonas campestris pv. campestris (strain 8004)
Q0AGX6 2.14e-21 95 32 5 199 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2Y7R3 2.58e-21 95 32 4 192 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1U0X4 2.67e-21 95 31 6 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A5IBF6 2.95e-21 94 31 4 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila (strain Corby)
Q3KF16 2.95e-21 94 33 6 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas fluorescens (strain Pf0-1)
A4VKF4 3.42e-21 94 32 6 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Stutzerimonas stutzeri (strain A1501)
Q47HQ6 3.54e-21 94 35 4 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Dechloromonas aromatica (strain RCB)
Q5X5Q3 4.34e-21 94 31 4 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila (strain Paris)
B1WT19 4.47e-21 94 32 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q5ZVY5 5.77e-21 94 31 4 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q1ICS3 7.36e-21 93 33 7 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas entomophila (strain L48)
Q9S3U4 1.49e-20 92 31 7 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / DSM 22645 / JCM 10191 / CCUG 17912 / NBRC 13757 / NCIMB 11200 / NRRL B-4491 / Barker I)
Q2RNS6 1.86e-20 92 33 7 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q56320 4.39e-20 91 32 9 205 1 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q74AH7 4.41e-20 91 33 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1B8L1 6.35e-20 91 37 8 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Paracoccus denitrificans (strain Pd 1222)
A5E8A5 8.66e-20 90 37 6 200 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q2SJD2 1.57e-19 90 31 8 198 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Hahella chejuensis (strain KCTC 2396)
Q07UH2 1.66e-19 90 35 8 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Rhodopseudomonas palustris (strain BisA53)
Q4KEZ9 1.75e-19 90 33 6 209 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1LA13 1.78e-19 89 32 9 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermotoga sp. (strain RQ2)
A5IKT2 1.78e-19 89 32 9 205 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A5N7N9 1.81e-19 89 33 8 202 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E150 1.81e-19 89 33 8 202 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Clostridium kluyveri (strain NBRC 12016)
Q39SQ9 2.57e-19 89 36 7 199 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4G4G1 2.82e-19 89 30 6 213 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Herminiimonas arsenicoxydans
A4YJI7 4.46e-19 89 35 5 199 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Bradyrhizobium sp. (strain ORS 278)
Q1QY43 6.32e-19 88 36 8 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A2SHS5 7.27e-19 88 33 6 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A9BHQ4 9.08e-19 87 33 7 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q9JVD1 1.14e-18 87 32 7 194 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1ANJ2 1.7e-18 87 34 3 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9M5M0 2.36e-18 86 33 5 196 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B3PFN8 2.9e-18 86 35 7 197 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Cellvibrio japonicus (strain Ueda107)
B0K2U0 3.04e-18 86 32 9 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermoanaerobacter sp. (strain X514)
A5GES5 3.32e-18 86 30 3 195 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geotalea uraniireducens (strain Rf4)
Q88WI1 3.63e-18 86 32 6 198 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0K8T5 3.81e-18 85 33 10 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A6V2W1 4.1e-18 85 36 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas aeruginosa (strain PA7)
Q2LUD8 4.64e-18 86 34 7 198 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Syntrophus aciditrophicus (strain SB)
Q3SHL8 5.37e-18 85 35 6 195 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Thiobacillus denitrificans (strain ATCC 25259)
Q8R9M8 6.69e-18 85 30 7 203 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B3E754 7.19e-18 85 29 3 191 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q2N9N2 7.39e-18 85 34 7 202 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Erythrobacter litoralis (strain HTCC2594)
A1WY07 7.73e-18 85 32 9 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Halorhodospira halophila (strain DSM 244 / SL1)
B4SQV5 8.9e-18 85 31 6 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Stenotrophomonas maltophilia (strain R551-3)
Q8UJB1 1.02e-17 85 34 8 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1CZH4 1.31e-17 84 40 9 201 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Myxococcus xanthus (strain DK1622)
A3DDS6 1.5e-17 84 32 8 208 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
C6C1D3 1.9e-17 84 34 8 198 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B2FNZ5 2.17e-17 84 31 6 206 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Stenotrophomonas maltophilia (strain K279a)
P20167 2.7e-17 84 29 7 216 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Bacillus subtilis (strain 168)
Q9Y8T7 3.58e-17 84 31 7 205 3 trpC Indole-3-glycerol phosphate synthase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q5HWC0 3.6e-17 83 29 6 200 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Campylobacter jejuni (strain RM1221)
Q9PIF3 3.6e-17 83 29 6 200 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B0KF94 4.78e-17 82 36 7 197 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain GB-1)
A5W6Y0 5.53e-17 82 36 7 197 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88LE0 5.91e-17 82 36 7 197 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q11KK8 6.1e-17 82 36 10 207 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Chelativorans sp. (strain BNC1)
B5EBV0 6.64e-17 82 31 3 193 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q01NI7 9.77e-17 81 40 7 193 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Solibacter usitatus (strain Ellin6076)
C6DYM2 1.01e-16 82 31 3 190 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Geobacter sp. (strain M21)
A3PPV2 1.02e-16 82 33 6 204 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A8FKD6 1.22e-16 81 29 6 200 3 trpF N-(5'-phosphoribosyl)anthranilate isomerase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05625
Feature type CDS
Gene trpCF
Product bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF
Location 1196799 - 1198166 (strand: 1)
Length 1368 (nucleotides) / 455 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1015
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00218 Indole-3-glycerol phosphate synthase
PF00697 N-(5'phosphoribosyl)anthranilate (PRA) isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0134 Amino acid transport and metabolism (E) E Indole-3-glycerol phosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13498 indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24] Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Tryptophan biosynthesis, chorismate => tryptophan

Protein Sequence

MKGTVLEQIINDKRISLIERKKQEPLLNFADTLQPSDRDFYQALSSTKTVYILECKKASPSKGLIRQNFNPEEIALAYAPYAAAVSVLTDEKYFQGQHDYLRRVRAQISQPVLCKDFMIDAYQVYLARHYGADAILLMLSVLNDAEYHSLATLAHSLNMGVLTEVSTEEELTRAIHLEAKVIGINNRDLRDLSIDRNRTKDFAPRIPADCIIISESGITTHQHIRELSPYANGFLIGSAIMAQADLDFAIRRLIFGEHKVCGLTRADDASAVYDAGGTFGGLIFVSDSPRYVNETQAAVVISGAPLAYVGVFRNHDPAEIAAIARRLKLHAVQLHGSEDAHDIAMLRLHLPVQCEIWKALDMSHQPDITVPDGVVRLVLDNGKGGSGHTFDWTTLPASLPVPFTLAGGLNAENCLAAVSCAASGLDFNSGAESAPGIKDADKIRILFEKLHMHVA

Flanking regions ( +/- flanking 50bp)

GGCAACGCCTTTGAGCGCGTCACCGCCCTGGCCGCGAGAGGATAATGACCATGAAAGGCACCGTATTAGAACAAATCATCAATGATAAACGTATCTCATTGATCGAGCGGAAAAAACAAGAGCCATTACTGAATTTTGCCGATACATTACAGCCAAGTGACCGGGATTTTTATCAGGCACTGAGCAGCACAAAAACAGTGTATATCTTAGAATGCAAGAAAGCATCGCCATCCAAAGGACTGATCCGACAGAATTTTAATCCGGAAGAGATTGCCCTTGCTTATGCACCTTATGCAGCCGCAGTGTCTGTTCTGACAGATGAAAAATACTTTCAGGGGCAGCATGACTATCTGCGCCGGGTACGAGCGCAGATTTCACAGCCGGTACTGTGCAAAGATTTTATGATTGATGCCTATCAGGTCTATCTGGCACGCCATTACGGTGCTGATGCGATTTTACTGATGCTGTCTGTGCTCAATGATGCGGAATATCACTCTCTCGCGACCCTTGCTCACTCTCTGAATATGGGCGTGCTGACAGAAGTCAGTACAGAAGAGGAACTGACCCGCGCCATTCATCTGGAGGCAAAAGTCATCGGTATTAATAACCGAGACTTACGCGATCTCTCGATTGATCGCAACCGCACAAAAGACTTTGCGCCGCGCATTCCGGCTGACTGCATTATTATCAGCGAATCAGGCATTACCACGCATCAGCACATCCGCGAGCTCTCCCCGTATGCCAATGGGTTTCTGATCGGCAGTGCGATTATGGCGCAGGCGGATCTGGATTTTGCTATCCGCCGCCTGATATTCGGTGAGCACAAAGTGTGCGGACTGACCCGCGCAGATGATGCCAGCGCCGTCTATGACGCCGGTGGCACATTTGGCGGACTGATATTTGTCAGTGATTCCCCGCGTTATGTGAATGAAACACAAGCCGCTGTTGTTATATCCGGCGCACCGCTGGCGTATGTCGGTGTGTTCCGAAATCACGACCCGGCAGAGATTGCCGCCATTGCCCGCCGCCTGAAACTGCATGCTGTTCAGTTACACGGCAGCGAAGATGCCCATGATATTGCGATGCTCCGCCTGCATCTGCCGGTGCAGTGTGAAATCTGGAAAGCGCTGGATATGTCACATCAGCCTGATATTACCGTGCCTGACGGCGTGGTGCGCCTGGTTCTGGATAACGGTAAAGGCGGCTCCGGACATACATTTGACTGGACAACACTGCCCGCCTCACTGCCGGTGCCCTTTACCCTTGCGGGCGGGCTGAATGCGGAAAACTGCCTTGCAGCTGTATCCTGCGCCGCATCCGGGCTGGATTTTAACTCCGGCGCAGAATCCGCCCCCGGAATTAAAGATGCAGACAAAATCCGCATCTTATTTGAAAAATTACATATGCACGTTGCCTAACGACTTAAACAGAAAGGATCAGAAAAATGAGTAAGTTAAATCCCTATTTT