Homologs in group_1595

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10020 FBDBKF_10020 100.0 Morganella morganii S1 hisM ABC-type amino acid transport system, permease component
NLDBIP_04820 NLDBIP_04820 100.0 Morganella morganii S4 hisM ABC-type amino acid transport system, permease component
LHKJJB_13810 LHKJJB_13810 100.0 Morganella morganii S3 hisM ABC-type amino acid transport system, permease component
HKOGLL_12725 HKOGLL_12725 100.0 Morganella morganii S5 hisM ABC-type amino acid transport system, permease component
F4V73_RS00315 F4V73_RS00315 95.9 Morganella psychrotolerans - amino acid ABC transporter permease
PMI_RS02150 PMI_RS02150 86.1 Proteus mirabilis HI4320 - amino acid ABC transporter permease

Distribution of the homologs in the orthogroup group_1595

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1595

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AER3 4.05e-146 410 81 0 244 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 4.05e-146 410 81 0 244 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34671 6.63e-28 108 30 3 214 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
P52625 3.75e-24 99 30 2 202 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
P0AFT4 7.5e-24 98 31 4 223 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 7.5e-24 98 31 4 223 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 7.5e-24 98 31 4 223 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER5 4.11e-23 96 27 1 215 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 4.11e-23 96 27 1 215 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 4.11e-23 96 27 1 215 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
P0AEQ9 4.32e-23 96 25 4 236 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 4.32e-23 96 25 4 236 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 4.32e-23 96 25 4 236 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 4.32e-23 96 25 4 236 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
P45767 1.37e-22 98 41 1 124 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
P45767 1.08e-06 52 36 0 85 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
P42200 3.37e-20 89 28 4 214 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
Q52813 6.44e-20 90 37 0 129 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q52813 1.57e-06 52 36 0 76 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8NQU3 6.89e-20 89 28 4 209 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
O34606 1.28e-19 87 26 3 222 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
P54536 1.86e-19 86 30 4 179 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
P54953 3.63e-19 86 30 2 180 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
Q52664 8.75e-19 87 37 2 143 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q52664 1.24e-05 49 32 1 80 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34315 1.93e-18 84 26 2 210 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
P35113 6.3e-18 83 28 4 234 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
P41083 2.18e-17 81 27 4 218 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
P45090 6.51e-17 80 25 3 220 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q52814 9.91e-17 81 27 2 168 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q68XN8 1.45e-16 79 27 4 218 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKC4 1.55e-16 79 26 3 216 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92J96 1.77e-16 79 26 5 237 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P55660 2.5e-16 79 26 2 217 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1RHC0 3.79e-16 77 26 4 219 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
Q8RQL4 9.92e-16 77 26 6 234 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P55661 1.45e-15 76 26 2 183 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0AEU6 1.69e-15 76 28 5 221 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 1.69e-15 76 28 5 221 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 1.69e-15 76 28 5 221 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 1.69e-15 76 28 5 221 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
P48244 1.82e-15 76 31 2 163 1 gluC Glutamate transport system permease protein GluC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8RQL5 3.02e-15 75 30 2 163 3 gluC Glutamate transport system permease protein GluC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P48245 4.03e-15 75 27 3 182 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P35114 4.76e-15 75 27 4 224 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P0A2I7 6.2e-15 75 27 5 221 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 6.2e-15 75 27 5 221 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
Q52665 7.75e-15 76 28 1 167 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P45023 2.93e-14 72 25 3 168 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34931 4.35e-14 72 26 3 211 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
P72296 2.21e-13 70 26 3 213 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
P42399 5.42e-13 69 25 4 219 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
P0AE33 4.31e-12 67 25 6 221 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 4.31e-12 67 25 6 221 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 4.31e-12 67 25 6 221 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 4.31e-12 67 25 6 221 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
P45768 9.77e-12 67 28 1 167 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
P35118 1.39e-11 65 27 3 181 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A2I9 5.37e-11 63 28 5 183 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 5.37e-11 63 28 5 183 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
P72295 6.68e-11 63 27 4 229 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
P52094 8.22e-11 63 27 5 183 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
P45089 3.92e-10 61 28 7 191 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4N5 5.41e-07 52 26 1 131 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 5.41e-07 52 26 1 131 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04820
Feature type CDS
Gene hisM
Product ABC-type amino acid transport system, permease component
Location 289490 - 290227 (strand: 1)
Length 738 (nucleotides) / 245 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1595
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0765 Amino acid transport and metabolism (E) E ABC-type amino acid transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10003 glutamate/aspartate transport system permease protein ABC transporters
Two-component system
-

Protein Sequence

MSANWDWGIFFQPAPFGNTTYLGWILSGLKVTVLLSICAWIIAFLVGSLFGILRTVPNKFLSSLGTIYVEIFRNVPLIVQFFTWYLVIPEFLPSSLRDWFKMDLDPNIQFFISSTLCLGLFTAARMTEQVRAAIQSLPRGQKAAGLAMGLTLPQTYRYVLLPNAYRVIIPPMTSEMLNLVKNSAIASTIGLVDMAAQAGKLLDYSARAYESFTAITLAYVGINVIIMLAMHLLEKRVRLPGTGGH

Flanking regions ( +/- flanking 50bp)

TGGTTATCCGTCTTATACAGGGAGTTCGTTCTTTTACCGGGAGCCGCGCTATGTCAGCTAACTGGGACTGGGGCATCTTTTTTCAGCCCGCCCCCTTCGGCAACACCACTTACCTCGGCTGGATCCTGTCCGGCCTGAAGGTCACTGTGCTGCTGTCAATCTGTGCCTGGATTATCGCCTTTCTGGTGGGATCCCTGTTCGGTATTCTCCGTACGGTACCGAATAAGTTTCTCTCCTCGCTCGGCACCATTTATGTGGAAATTTTCCGTAATGTGCCGCTGATCGTCCAGTTCTTCACCTGGTATCTGGTGATCCCGGAGTTTCTGCCGTCGTCCCTGCGCGACTGGTTTAAAATGGATCTCGACCCGAATATCCAGTTCTTTATTTCCTCCACCCTCTGTCTGGGGCTGTTTACCGCCGCCCGTATGACCGAACAGGTACGTGCCGCCATTCAGTCACTGCCGCGCGGCCAGAAAGCCGCAGGGCTGGCGATGGGACTGACACTGCCGCAGACTTACCGCTATGTGCTGCTGCCGAATGCCTACCGCGTGATTATTCCGCCGATGACATCGGAAATGCTCAATCTGGTGAAAAACTCCGCCATCGCCTCCACTATCGGGCTGGTCGATATGGCCGCACAGGCCGGGAAGTTACTGGATTACTCCGCCAGAGCCTATGAGTCCTTTACTGCGATCACCCTCGCCTATGTCGGCATCAACGTTATTATTATGCTGGCCATGCATTTACTGGAAAAACGGGTGCGTCTGCCCGGGACAGGAGGCCACTGATGTACGAATTTGACTGGAGTTCGGTGATGCCGGGTATGCCGTTCCTGTTA