Homologs in group_1508

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09750 FBDBKF_09750 100.0 Morganella morganii S1 tolR colicin uptake protein TolR
NLDBIP_04550 NLDBIP_04550 100.0 Morganella morganii S4 tolR colicin uptake protein TolR
LHKJJB_14080 LHKJJB_14080 100.0 Morganella morganii S3 tolR colicin uptake protein TolR
HKOGLL_12455 HKOGLL_12455 100.0 Morganella morganii S5 tolR colicin uptake protein TolR
F4V73_RS00590 F4V73_RS00590 92.2 Morganella psychrotolerans tolR colicin uptake protein TolR
PMI_RS02860 PMI_RS02860 73.0 Proteus mirabilis HI4320 tolR colicin uptake protein TolR

Distribution of the homologs in the orthogroup group_1508

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1508

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABV9 5.78e-57 177 73 0 132 3 tolR Tol-Pal system protein TolR Shigella flexneri
P0ABV6 5.78e-57 177 73 0 132 1 tolR Tol-Pal system protein TolR Escherichia coli (strain K12)
P0ABV7 5.78e-57 177 73 0 132 3 tolR Tol-Pal system protein TolR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABV8 5.78e-57 177 73 0 132 3 tolR Tol-Pal system protein TolR Escherichia coli O157:H7
P43769 4.36e-47 152 60 1 141 1 tolR Tol-Pal system protein TolR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P50599 7.56e-21 85 35 2 145 3 tolR Tol-Pal system protein TolR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A0S0 9.19e-13 64 31 4 130 3 exbD Biopolymer transport protein ExbD Neisseria meningitidis serogroup C
P0A0R9 9.19e-13 64 31 4 130 3 exbD Biopolymer transport protein ExbD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0R8 9.19e-13 64 31 4 130 3 exbD Biopolymer transport protein ExbD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
O06434 1.07e-12 64 31 4 130 3 exbD Biopolymer transport protein ExbD Neisseria gonorrhoeae
P0ABV5 6.52e-09 54 29 4 139 3 exbD Biopolymer transport protein ExbD Shigella flexneri
P0ABV2 6.52e-09 54 29 4 139 1 exbD Biopolymer transport protein ExbD Escherichia coli (strain K12)
P0ABV3 6.52e-09 54 29 4 139 3 exbD Biopolymer transport protein ExbD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABV4 6.52e-09 54 29 4 139 3 exbD Biopolymer transport protein ExbD Escherichia coli O157:H7
Q05606 2.87e-08 52 29 3 131 3 exbD Biopolymer transport protein ExbD Pseudomonas putida
Q9ZJP5 6.47e-08 51 29 3 126 3 exbD Biopolymer transport protein ExbD Helicobacter pylori (strain J99 / ATCC 700824)
P0C7M0 9.51e-08 51 48 0 50 3 exbD1 Biopolymer transport protein exbD1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RLE7 9.51e-08 51 48 0 50 3 exbD1 Biopolymer transport protein exbD1 Xanthomonas campestris pv. campestris (strain B100)
P0C7I9 1.06e-07 50 51 0 47 3 exbD2 Biopolymer transport protein exbD2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RLE8 1.06e-07 50 51 0 47 3 exbD2 Biopolymer transport protein exbD2 Xanthomonas campestris pv. campestris (strain B100)
P72203 1.18e-07 50 29 5 131 3 exbD Biopolymer transport protein ExbD Mannheimia haemolytica
O25898 1.42e-07 50 29 3 126 3 exbD Biopolymer transport protein ExbD Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZK84 1.62e-07 50 30 4 133 3 jhp_1057 Putative biopolymer transport protein ExbD-like 1 Helicobacter pylori (strain J99 / ATCC 700824)
O25754 2.15e-07 50 28 2 131 3 HP_1129 Putative biopolymer transport protein ExbD-like 1 Helicobacter pylori (strain ATCC 700392 / 26695)
O67694 9.49e-07 48 27 4 129 3 exbD Biopolymer transport protein ExbD Aquifex aeolicus (strain VF5)
O51809 1.37e-06 47 29 6 131 3 exbD Biopolymer transport protein ExbD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P43009 0.000626 40 50 1 38 3 exbD Biopolymer transport protein ExbD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RMT1 0.000678 40 31 5 140 3 exbD Biopolymer transport protein ExbD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72942 0.000773 41 25 4 135 3 slr0678 Putative biopolymer transport protein ExbD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04550
Feature type CDS
Gene tolR
Product colicin uptake protein TolR
Location 238536 - 238961 (strand: -1)
Length 426 (nucleotides) / 141 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1508
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02472 Biopolymer transport protein ExbD/TolR

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0848 Intracellular trafficking, secretion, and vesicular transport (U) U Biopolymer transport protein ExbD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03559 biopolymer transport protein ExbD - -

Protein Sequence

MARHRGRRRELKSEINIVPLLDVLLVLLLIFMATAPIISQSVEVDLPDASDSQSVSTNDNPPVILEVSGVGRYTLVVKQDRLELLPEEQIIAAAKQYLAEDPKTIFLVGGAKDVPYEEIINGLNILKQAGVKSVGLMTKPM

Flanking regions ( +/- flanking 50bp)

CATCGTCAGGCCTTTGCTACTGCTGATAAGAAATAAGGCAGGAGATTATCATGGCACGTCATCGCGGACGCCGGCGGGAGCTGAAATCCGAAATTAACATTGTTCCTTTACTGGACGTGTTACTCGTGTTGCTGCTGATCTTCATGGCAACAGCGCCGATCATCAGTCAGAGTGTGGAAGTGGATCTGCCGGATGCCTCCGATTCACAATCCGTTTCCACCAATGATAATCCGCCGGTGATTCTGGAAGTCTCCGGTGTCGGCCGCTACACCCTGGTCGTGAAGCAGGATCGTCTGGAACTGTTACCGGAAGAGCAGATCATTGCTGCGGCAAAACAGTATCTGGCTGAAGATCCGAAGACTATTTTCCTGGTCGGCGGTGCCAAAGATGTGCCTTACGAAGAGATTATTAATGGCCTGAATATTCTGAAACAGGCCGGAGTGAAATCTGTGGGCCTGATGACGAAGCCGATGTAAGGTTTGTTATGCAGATGTTTTCACTCAGAAGGTTAGGGAATTAAGCGTGG