Homologs in group_229

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00975 FBDBKF_00975 100.0 Morganella morganii S1 cysM cysteine synthase CysM
NLDBIP_02890 NLDBIP_02890 100.0 Morganella morganii S4 cysM cysteine synthase CysM
LHKJJB_04405 LHKJJB_04405 100.0 Morganella morganii S3 cysM cysteine synthase CysM
HKOGLL_02640 HKOGLL_02640 100.0 Morganella morganii S5 cysM cysteine synthase CysM
F4V73_RS07050 F4V73_RS07050 92.2 Morganella psychrotolerans cysM cysteine synthase CysM
PMI_RS01140 PMI_RS01140 37.0 Proteus mirabilis HI4320 - cysteine synthase family protein
PMI_RS09035 PMI_RS09035 76.5 Proteus mirabilis HI4320 cysM cysteine synthase CysM

Distribution of the homologs in the orthogroup group_229

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_229

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P16703 1.46e-161 454 73 0 293 1 cysM Cysteine synthase B Escherichia coli (strain K12)
P29848 6.61e-160 450 72 0 293 1 cysM Cysteine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9I526 2.5e-138 395 66 0 290 3 cysM Cysteine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O32978 2.99e-75 235 44 3 300 3 cysK O-acetylserine sulfhydrylase Mycobacterium leprae (strain TN)
P31300 9.41e-75 236 47 4 293 2 None Cysteine synthase, chloroplastic/chromoplastic Capsicum annuum
Q7DDL5 2.76e-74 233 44 4 302 1 cysK Cysteine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O45679 4.07e-74 233 44 4 296 1 cysl-2 Bifunctional L-3-cyanoalanine synthase/cysteine synthase Caenorhabditis elegans
P63872 4.49e-74 232 41 3 299 3 cysK Cysteine synthase Staphylococcus aureus (strain MW2)
Q6GBX5 4.49e-74 232 41 3 299 3 cysK Cysteine synthase Staphylococcus aureus (strain MSSA476)
Q6GJF8 4.49e-74 232 41 3 299 3 cysK Cysteine synthase Staphylococcus aureus (strain MRSA252)
P63871 4.49e-74 232 41 3 299 1 cysK Cysteine synthase Staphylococcus aureus (strain N315)
P63870 4.49e-74 232 41 3 299 3 cysK Cysteine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIG2 4.49e-74 232 41 3 299 3 cysK Cysteine synthase Staphylococcus aureus (strain COL)
Q8CMT6 1.13e-73 231 41 3 298 3 cysK Cysteine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRP1 1.13e-73 231 41 3 298 3 cysK Cysteine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O01592 1.85e-73 231 44 4 296 1 cysl-3 Cysteine synthase 3 Caenorhabditis elegans
P32260 6.19e-73 231 45 4 300 1 CYSK Cysteine synthase, chloroplastic/chromoplastic Spinacia oleracea
O23733 7.79e-73 229 45 4 300 2 None Cysteine synthase Brassica juncea
O81155 2.14e-72 230 45 4 300 2 None Cysteine synthase, chloroplastic/chromoplastic Solanum tuberosum
Q00834 5.31e-72 227 44 4 300 1 None Cysteine synthase Spinacia oleracea
Q43153 8.85e-71 226 43 4 301 1 CYSC Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial Spinacia oleracea
O23735 1.46e-70 224 44 4 300 2 None Cysteine synthase Brassica juncea
Q43317 4.64e-70 222 45 4 300 1 None Cysteine synthase Citrullus lanatus
P9WP55 6.2e-70 221 43 3 300 1 cysK1 O-acetylserine sulfhydrylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP54 6.2e-70 221 43 3 300 3 cysK1 O-acetylserine sulfhydrylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A535 6.2e-70 221 43 3 300 3 cysK O-acetylserine sulfhydrylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P48028 8.16e-70 216 66 0 162 3 cysM Cysteine synthase B (Fragment) Pseudomonas syringae pv. syringae
P47998 8.96e-70 221 44 4 300 1 OASA1 Cysteine synthase 1 Arabidopsis thaliana
P80608 2.35e-69 221 45 4 300 1 None Cysteine synthase Zea mays
P73410 4.15e-69 219 48 7 305 3 cysK Cysteine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A1E3 5.38e-69 219 45 7 304 1 cysK Cysteine synthase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1E4 5.38e-69 219 45 7 304 3 cysK Cysteine synthase A Salmonella typhi
Q9XEA8 5.52e-69 219 45 4 296 2 RCS3 Cysteine synthase Oryza sativa subsp. japonica
Q43725 1.01e-68 222 44 4 301 1 OASC Cysteine synthase, mitochondrial Arabidopsis thaliana
Q5XAQ3 1.94e-68 218 40 3 299 1 cysK Cysteine synthase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0ABK5 3.24e-68 218 44 7 304 1 cysK Cysteine synthase A Escherichia coli (strain K12)
P0ABK6 3.24e-68 218 44 7 304 3 cysK Cysteine synthase A Escherichia coli O157:H7
Q9XEA6 3.44e-68 218 43 4 300 2 RCS1 Cysteine synthase Oryza sativa subsp. japonica
P37887 9.77e-68 216 43 3 299 1 cysK Cysteine synthase Bacillus subtilis (strain 168)
O81154 2.23e-67 216 41 4 300 2 None Cysteine synthase Solanum tuberosum
O67507 4.97e-67 214 44 7 303 3 cysM Cysteine synthase Aquifex aeolicus (strain VF5)
P47999 9.8e-67 216 44 4 296 1 OASB Cysteine synthase, chloroplastic/chromoplastic Arabidopsis thaliana
Q93244 1.98e-66 214 42 5 297 1 cysl-1 Cysteine synthase 1 Caenorhabditis elegans
O34476 1.03e-65 211 43 6 307 3 ytkP Probable cysteine synthase Bacillus subtilis (strain 168)
P38076 1.06e-65 211 42 4 300 2 CYS1 Cysteine synthase Triticum aestivum
Q1KLZ2 1.2e-65 213 41 4 300 1 CAS1 L-3-cyanoalanine synthase 1, mitochondrial Malus domestica
D2Z027 4.57e-64 207 42 5 300 1 dcsD O-ureido-L-serine synthase Streptomyces lavendulae
Q1KLZ1 8.01e-64 208 40 4 300 1 CAS2 L-3-cyanoalanine synthase 2, mitochondrial Malus domestica
Q76MX2 1.76e-63 206 40 6 303 1 PCAS-1 Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial Solanum tuberosum
Q9S6Z7 9.89e-63 204 41 4 296 1 CYSD1 Bifunctional L-3-cyanoalanine synthase/cysteine synthase D1 Arabidopsis thaliana
Q9FS29 1.86e-62 204 40 5 302 1 PCAS-2 Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial Solanum tuberosum
Q59966 3.77e-62 202 45 6 311 2 srpG Cysteine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O22682 2.5e-61 202 40 4 294 1 CS26 S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent), chloroplastic Arabidopsis thaliana
F4K5T2 5.48e-61 199 42 4 300 1 DES1 Bifunctional cystathionine gamma-lyase/cysteine synthase Arabidopsis thaliana
Q59447 1.4e-60 197 41 3 254 3 cysK Cysteine synthase Flavobacterium sp. (strain K3-15 / DSM ID92-509)
Q9S757 3.76e-59 196 39 4 296 1 CYSC1 Bifunctional L-3-cyanoalanine synthase/cysteine synthase C1, mitochondrial Arabidopsis thaliana
Q9SXS7 5.74e-59 194 42 4 300 1 CYSD2 Bifunctional L-3-cyanoalanine synthase/cysteine synthase D2 Arabidopsis thaliana
P71128 4.37e-58 191 36 5 301 3 cysM Cysteine synthase B Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P35520 2.29e-57 196 38 6 307 1 CBS Cystathionine beta-synthase Homo sapiens
Q54CN7 1.56e-56 189 36 9 319 3 cysK Cysteine synthase Dictyostelium discoideum
Q58H57 2.12e-56 193 37 6 307 2 CBS Cystathionine beta-synthase Macaca fascicularis
P45040 2.82e-56 187 42 7 306 1 cysK Cysteine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57171 1.33e-55 185 41 6 305 3 cysK Cysteine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P32232 1.57e-55 191 38 6 307 1 Cbs Cystathionine beta-synthase Rattus norvegicus
P9WP51 1.84e-55 189 39 6 298 1 cbs Probable cystathionine beta-synthase Rv1077 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP50 1.84e-55 189 39 6 298 3 cbs Putative cystathionine beta-synthase MT1108 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q91WT9 1.93e-55 191 37 6 307 1 Cbs Cystathionine beta-synthase Mus musculus
O05393 3.2e-55 184 37 4 300 1 mccA O-acetylserine dependent cystathionine beta-synthase Bacillus subtilis (strain 168)
P56067 3.9e-55 183 35 5 303 1 cysM Cysteine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
P9WP53 4.94e-53 179 37 4 302 1 cysM O-phosphoserine sulfhydrylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP52 4.94e-53 179 37 4 302 3 cysM O-phosphoserine sulfhydrylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63874 4.94e-53 179 37 4 302 3 cysM O-phosphoserine sulfhydrylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O59701 1.29e-52 178 37 6 304 1 cys11 Cysteine synthase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8KA48 1.53e-52 177 40 7 305 3 cysK Cysteine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9N0V7 2.74e-52 182 40 5 270 2 CBS Cystathionine beta-synthase Oryctolagus cuniculus
Q2V0C9 1.24e-51 179 40 6 277 1 CBS Cystathionine beta-synthase Apis mellifera
P46794 1.86e-50 176 37 5 307 2 cysB Cystathionine beta-synthase Dictyostelium discoideum
Q9ZMW6 2.05e-49 169 35 6 306 3 cysM Cysteine synthase Helicobacter pylori (strain J99 / ATCC 700824)
P32582 1.57e-48 171 37 8 312 1 CYS4 Cystathionine beta-synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9LJA0 3.57e-48 162 48 2 177 5 OASA2 Putative inactive cysteine synthase 2 Arabidopsis thaliana
P87131 1.79e-47 166 33 8 323 3 cys12 Cysteine synthase 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P50867 1.57e-46 163 34 5 305 3 cysB Cysteine synthase 1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BD67 2.09e-46 164 36 9 334 3 cysF Cysteine synthase 2 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7A1Z6 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MW2)
A8YZ41 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD09 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MSSA476)
Q6GKI9 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MRSA252)
Q932K9 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QDA0 9.64e-45 157 35 7 298 1 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain Newman)
D0K799 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain ED98)
Q5HJQ3 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain COL)
A5INY7 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain JH9)
Q2G1N3 9.64e-45 157 35 7 298 1 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
D2N3G7 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain MRSA ST398 / isolate S0385)
D3ERF5 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain 04-02981)
Q2FKE3 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain USA300)
A6TXQ1 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain JH1)
A7WX68 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
D1GUM7 9.64e-45 157 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain TW20 / 0582)
Q2YUU0 3.17e-44 155 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7RYW6 4.71e-44 157 37 7 311 3 cys-17 Cysteine synthase 1 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q99X99 2.63e-43 153 35 7 298 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Staphylococcus aureus (strain N315)
Q44004 2.96e-41 148 33 6 305 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7SHQ1 7.2e-41 150 35 9 327 3 cys-12 Cysteine synthase 2 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
G5EFH8 2.5e-39 149 36 8 291 1 cbs-1 Cystathionine beta-synthase cbs-1 Caenorhabditis elegans
G5EFH8 3.08e-12 70 27 10 293 1 cbs-1 Cystathionine beta-synthase cbs-1 Caenorhabditis elegans
Q8XSQ0 2.11e-38 141 35 8 301 3 sbnA N-(2-amino-2-carboxyethyl)-L-glutamate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9N4K2 3.47e-38 145 37 8 288 2 cbs-2 Putative cystathionine beta-synthase cbs-2 Caenorhabditis elegans
Q9N4K2 5.63e-07 54 25 8 267 2 cbs-2 Putative cystathionine beta-synthase cbs-2 Caenorhabditis elegans
P53206 2.13e-36 137 32 9 323 1 MCY1 Putative mitochondrial cysteine synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P55708 2.25e-32 125 31 9 306 3 NGR_a00730 Putative cysteine synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9YBL2 8.3e-25 105 32 10 287 1 cysO Protein CysO Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q79FV4 4.93e-21 95 31 9 299 1 cysK2 S-sulfocysteine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q59918 7.9e-21 89 33 3 149 3 cysK Cysteine synthase (Fragment) Staphylococcus haemolyticus
O69652 2.19e-13 73 23 6 296 1 cds1 L-cysteine desulfhydrase Cds1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U908 2.19e-13 73 23 6 296 1 cds1 L-cysteine desulfhydrase Cds1 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q58860 1.86e-12 70 26 12 293 3 thrC Threonine synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8TQD4 1.91e-10 64 30 5 182 1 thrC Threonine synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
C1FW07 4.58e-10 63 25 13 320 1 ortB 2-amino-4-ketopentanoate thiolase beta subunit Unknown prokaryotic organism
Q9GZT4 1.36e-09 61 20 6 311 1 SRR Serine racemase Homo sapiens
P04990 1.56e-09 61 25 8 318 3 thrC Threonine synthase Bacillus subtilis (strain 168)
P09123 4.51e-09 60 27 11 301 3 thrC Threonine synthase Bacillus sp. (strain ULM1)
A0JNI4 1.29e-08 58 23 7 282 2 SRR Serine racemase Bos taurus
A1B8Z2 1.5e-08 58 23 5 225 1 bhcB beta-hydroxyaspartate dehydratase Paracoccus denitrificans (strain Pd 1222)
Q19374 3.85e-08 57 21 13 337 1 F13B12.4 Putative pyridoxal-phosphate dependent protein F13B12.4 Caenorhabditis elegans
P36007 5.4e-08 56 23 6 282 1 SRY1 L-threo-3-hydroxyaspartate ammonia-lyase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q54HH2 6.75e-08 56 22 10 284 1 srr Serine racemase Dictyostelium discoideum
Q9CKJ2 8.01e-08 56 24 8 274 3 ilvA L-threonine dehydratase biosynthetic IlvA Pasteurella multocida (strain Pm70)
A0FKE6 8.87e-08 56 29 4 192 1 TD1 Threonine dehydratase 1 biosynthetic, chloroplastic Solanum lycopersicum
Q9AXU4 1.36e-07 56 28 5 191 1 TD Threonine dehydratase Nicotiana attenuata
P46493 1.58e-07 55 23 8 272 3 ilvA L-threonine dehydratase biosynthetic IlvA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q10725 2.67e-07 54 27 6 201 1 psdht Phenylserine dehydratase Ralstonia pickettii
P45837 2.9e-07 54 32 5 143 3 thrC Threonine synthase Mycobacterium leprae (strain TN)
Q9K7E3 4.72e-07 53 24 9 310 3 thrC Threonine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A0R220 4.88e-07 53 26 12 293 1 thrC Threonine synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9WYJ1 1.03e-06 53 24 8 269 1 TM_0356 L-threonine ammonia-lyase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7A5L8 1.06e-06 53 24 7 271 1 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain N315)
Q99U50 1.06e-06 53 24 7 271 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain Mu50 / ATCC 700699)
O94634 1.11e-06 53 26 5 199 3 SPBC1677.03c Threonine dehydratase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8NWQ4 1.14e-06 52 24 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain MW2)
Q6G9C4 1.14e-06 52 24 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain MSSA476)
Q6GGX0 1.14e-06 52 24 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain MRSA252)
Q5HFY5 1.14e-06 52 24 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain COL)
Q2FYJ3 1.14e-06 52 24 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH01 1.14e-06 52 24 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain USA300)
P25306 5.34e-06 51 27 7 192 1 TD2 Threonine dehydratase 2 biosynthetic, chloroplastic Solanum lycopersicum
Q9CC54 1.05e-05 50 25 13 341 3 trpB Tryptophan synthase beta chain Mycobacterium leprae (strain TN)
Q9QZX7 1.67e-05 49 24 1 142 1 Srr Serine racemase Mus musculus
P9WG59 1.79e-05 49 31 4 139 1 thrC Threonine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG58 1.79e-05 49 31 4 139 3 thrC Threonine synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66903 1.79e-05 49 31 4 139 3 thrC Threonine synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2YY67 1.86e-05 49 23 7 273 3 tdcB L-threonine dehydratase catabolic TdcB Staphylococcus aureus (strain bovine RF122 / ET3-1)
O59791 2.5e-05 48 21 6 268 1 sry1 Serine racemase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9ZSS6 3.5e-05 48 27 5 197 1 OMR1 Threonine dehydratase biosynthetic, chloroplastic Arabidopsis thaliana
Q76EQ0 3.62e-05 48 25 3 143 1 Srr Serine racemase Rattus norvegicus
Q7XSN8 5.33e-05 47 22 9 281 1 SERR Serine racemase Oryza sativa subsp. japonica
A2XWA9 5.33e-05 47 22 9 281 3 OsI_16936 Serine racemase Oryza sativa subsp. indica
Q04513 7.86e-05 47 27 5 204 3 ilvA L-threonine dehydratase biosynthetic IlvA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4F2N8 0.000181 46 23 8 263 1 thadh L-threo-3-hydroxyaspartate ammonia-lyase Pseudomonas sp.
Q2PGG3 0.000245 45 26 6 195 1 SR Serine racemase Arabidopsis thaliana
P9WFX9 0.000261 45 25 13 339 1 trpB Tryptophan synthase beta chain Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX8 0.000261 45 25 13 339 3 trpB Tryptophan synthase beta chain Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66985 0.000261 45 25 13 339 3 trpB Tryptophan synthase beta chain Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A3SQG3 0.000367 45 29 10 209 1 cuyA L-cysteate sulfo-lyase Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM)
P74193 0.000535 44 26 14 311 3 thrC Threonine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0A6N3IN21 0.000823 43 28 4 135 1 Sdsl Serine dehydratase-like Rattus norvegicus

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00570
Feature type CDS
Gene cysM
Product cysteine synthase CysM
Location 130877 - 131758 (strand: 1)
Length 882 (nucleotides) / 293 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_229
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00291 Pyridoxal-phosphate dependent enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0031 Amino acid transport and metabolism (E) E Cysteine synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12339 S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) [EC:2.5.1.144] Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of amino acids		 -

Protein Sequence

MASISNGIGNTPLFRLARLGEVSGAEIWVKPEGNNPGGSVKDRAAKSMIEGAEQRGEIRPGDTLIEATSGNTGIALAMIAAIRGYKLKLLMPENMSAERQAAMKAYGAELVLVSRAQGMEGARDLAQQMAADGEGYVLDQFNNPDNPLAHYRTTGPEIWQQTDGRITHFVSAMGTTGTITGVARYLKEVAPQINITGLQPAENSQIPGIRRWSPGYLPGIFQPQLVDDILDITQQEAEDTMRQLAQQEGIFCGVSSGGAVAGALRIAKANPGAVIVAVICDRGDRYLSTGVFG

Flanking regions ( +/- flanking 50bp)

CCTTGCGGCGGCGGTATGGTTTCCGTTTATGGCTCAGGAGGCAGAACAACGTGGCATCTATCAGTAATGGGATCGGTAATACCCCGCTTTTCCGGCTTGCACGGTTGGGTGAAGTCAGTGGCGCAGAAATCTGGGTCAAACCGGAAGGTAATAACCCCGGCGGCTCTGTAAAAGATCGTGCGGCGAAAAGTATGATTGAAGGTGCTGAACAGCGCGGGGAGATCCGTCCCGGGGATACGCTGATTGAAGCCACCAGCGGTAACACCGGTATTGCGCTGGCGATGATCGCAGCGATTCGCGGTTATAAATTAAAGTTGCTGATGCCGGAAAATATGAGTGCCGAACGTCAGGCCGCCATGAAAGCTTACGGCGCGGAGCTGGTGCTGGTCAGCCGGGCACAGGGCATGGAAGGGGCGCGGGACCTGGCGCAGCAGATGGCAGCGGACGGGGAAGGTTATGTGCTTGATCAGTTTAATAATCCCGATAACCCGCTGGCCCATTACCGGACAACAGGCCCGGAAATCTGGCAGCAGACGGACGGGCGTATCACGCACTTTGTCTCAGCTATGGGCACTACCGGCACCATTACCGGGGTGGCGCGTTATCTGAAAGAGGTCGCACCGCAGATCAATATCACCGGTCTGCAACCGGCGGAAAACAGTCAGATTCCGGGGATCCGCCGCTGGTCACCGGGGTATCTGCCGGGGATTTTTCAGCCGCAGCTGGTGGATGATATTCTGGATATCACACAGCAGGAAGCAGAAGATACGATGCGCCAGCTGGCACAACAGGAAGGCATTTTCTGCGGGGTCAGTTCCGGCGGCGCGGTGGCCGGTGCACTGAGAATTGCAAAAGCGAACCCGGGAGCGGTGATTGTCGCCGTAATCTGCGATCGCGGCGACCGTTATCTCTCGACCGGCGTTTTCGGCTGAGACATTATCCCGCTGTTTTGCCGGTGTATTTCATGTGCAGCAGCGGGAAC