Homologs in group_259

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06290 FBDBKF_06290 42.5 Morganella morganii S1 - Polymerase nucleotidyl transferase domain-containing protein
EHELCC_09335 EHELCC_09335 42.5 Morganella morganii S2 - Polymerase nucleotidyl transferase domain-containing protein
NLDBIP_09715 NLDBIP_09715 42.5 Morganella morganii S4 - Polymerase nucleotidyl transferase domain-containing protein
LHKJJB_08040 LHKJJB_08040 42.5 Morganella morganii S3 - Polymerase nucleotidyl transferase domain-containing protein
HKOGLL_07590 HKOGLL_07590 42.5 Morganella morganii S5 - Polymerase nucleotidyl transferase domain-containing protein
F4V73_RS15630 F4V73_RS15630 41.2 Morganella psychrotolerans - nucleotidyltransferase domain-containing protein
PMI_RS09465 PMI_RS09465 22.6 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_259

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_259

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19645
Feature type CDS
Gene -
Product nucleotidyltransferase domain-containing protein
Location 2062726 - 2063010 (strand: -1)
Length 285 (nucleotides) / 94 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_259
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01909 Nucleotidyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1669 General function prediction only (R) R Predicted nucleotidyltransferase MJ0435

Protein Sequence

MAVDHNDFISQPRRAEIQPEFSHIIECVVTNLTRYFPKLIHSLYVYGSVAEGRAEVGKSDLDMTVIFKYEPDQTIKEQFATVQSVLEKKQSRYQ

Flanking regions ( +/- flanking 50bp)

TTCAAAATGCCTGTTATCAGGAAAAATAACATTAGCAAACAGGAGAAAAGATGGCCGTCGATCATAATGATTTTATTTCCCAGCCAAGACGCGCGGAAATTCAACCTGAATTCTCACATATAATTGAATGTGTTGTGACAAATCTAACACGTTACTTTCCTAAGCTTATACACAGTCTATACGTATACGGAAGTGTAGCTGAAGGCCGGGCAGAAGTAGGTAAGTCTGATCTGGATATGACAGTTATTTTCAAATATGAACCTGATCAGACTATTAAAGAGCAATTTGCAACTGTTCAGTCTGTTCTTGAAAAAAAACAATCCCGTTATCAGTAAAATTGATTTTGATTGTGGTCTGTTAGAACAGGTTCTCGATCCAGATAATG