Homologs in group_767

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03535 FBDBKF_03535 61.3 Morganella morganii S1 rsmD 16S rRNA (guanine(966)-N(2))-methyltransferase
EHELCC_07000 EHELCC_07000 61.3 Morganella morganii S2 rsmD 16S rRNA (guanine(966)-N(2))-methyltransferase
NLDBIP_07325 NLDBIP_07325 61.3 Morganella morganii S4 rsmD 16S rRNA (guanine(966)-N(2))-methyltransferase
LHKJJB_06860 LHKJJB_06860 61.3 Morganella morganii S3 rsmD 16S rRNA (guanine(966)-N(2))-methyltransferase
HKOGLL_04070 HKOGLL_04070 61.3 Morganella morganii S5 rsmD 16S rRNA (guanine(966)-N(2))-methyltransferase
F4V73_RS11365 F4V73_RS11365 61.3 Morganella psychrotolerans rsmD 16S rRNA (guanine(966)-N(2))-methyltransferase

Distribution of the homologs in the orthogroup group_767

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_767

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADX9 1.29e-87 258 63 0 188 1 rsmD Ribosomal RNA small subunit methyltransferase D Escherichia coli (strain K12)
P0ADY0 1.29e-87 258 63 0 188 3 rsmD Ribosomal RNA small subunit methyltransferase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44869 1.35e-63 197 53 3 182 1 rsmD Ribosomal RNA small subunit methyltransferase D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57136 1.06e-54 175 43 2 180 3 rsmD Ribosomal RNA small subunit methyltransferase D Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89B29 1.06e-48 160 41 2 186 3 rsmD Ribosomal RNA small subunit methyltransferase D Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O34331 1.36e-29 110 35 2 180 3 ylbH Putative rRNA methyltransferase YlbH Bacillus subtilis (strain 168)
I6XFS7 2.81e-24 97 35 6 185 1 Rv2966c RNA/DNA methyltransferase Rv2966c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9ZD05 2.6e-19 85 28 6 225 4 RP545 Uncharacterized methylase RP545 Rickettsia prowazekii (strain Madrid E)
Q8DKB7 2.55e-05 47 31 2 93 3 tlr0942 Uncharacterized RNA methyltransferase tlr0942 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B5XY38 3.27e-05 47 26 3 110 3 rlmI Ribosomal RNA large subunit methyltransferase I Klebsiella pneumoniae (strain 342)
A6T766 6.41e-05 46 25 3 110 3 rlmI Ribosomal RNA large subunit methyltransferase I Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4SML8 0.00025 44 33 2 80 3 rlmI Ribosomal RNA large subunit methyltransferase I Aeromonas salmonicida (strain A449)
A7ME44 0.000453 43 24 3 110 3 rlmI Ribosomal RNA large subunit methyltransferase I Cronobacter sakazakii (strain ATCC BAA-894)
A4W8X9 0.000651 43 24 3 110 3 rlmI Ribosomal RNA large subunit methyltransferase I Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17935
Feature type CDS
Gene rsmD
Product 16S rRNA (guanine(966)-N(2))-methyltransferase
Location 3941482 - 3942066 (strand: -1)
Length 585 (nucleotides) / 194 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_767
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03602 Conserved hypothetical protein 95

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0742 Translation, ribosomal structure and biogenesis (J) J 16S rRNA G966 N2-methylase RsmD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08316 16S rRNA (guanine966-N2)-methyltransferase [EC:2.1.1.171] - -

Protein Sequence

MAKKPQKTPMGQIRIIGGKWRGRKLPVLDSQGLRPTTDRVKETLFNWLMPVIQDARCLDCFAGSGGLGIEALSRYAKETTFIEFDRKVAQQITANLALLGADNGHVIQDSALNYLAKQGTAYDVVFLDPPFHQGMLANTLQLLENNQWLAEGCYIYIEEEVNAQVYSLPENWRLHREKIAGQVAYRLYIRNLSA

Flanking regions ( +/- flanking 50bp)

ACATTAAAACACGCCAAAATTCACGCTTAAACGATATATATCAGAAAAATATGGCTAAGAAACCACAAAAAACGCCGATGGGACAAATCAGAATAATCGGAGGTAAATGGCGTGGTCGGAAACTTCCTGTGCTTGATAGCCAAGGATTACGTCCCACCACCGATAGAGTCAAAGAAACACTGTTTAATTGGCTTATGCCCGTTATTCAGGACGCTCGTTGCTTAGATTGCTTTGCCGGCAGTGGTGGGCTAGGTATTGAAGCACTCTCTCGCTATGCAAAAGAAACGACATTCATTGAGTTCGACCGTAAAGTCGCGCAACAAATTACTGCTAATTTAGCGCTGCTTGGCGCTGATAATGGGCATGTTATTCAAGATAGTGCGTTAAATTATCTAGCTAAACAAGGTACGGCATATGATGTGGTGTTTTTAGATCCTCCTTTTCATCAAGGTATGTTGGCAAACACCCTGCAATTATTAGAAAATAACCAATGGTTAGCCGAAGGTTGTTATATTTATATTGAAGAAGAAGTAAACGCACAGGTTTATTCTTTACCAGAAAATTGGCGATTACATAGAGAAAAAATCGCAGGCCAAGTCGCCTATCGTCTCTATATTCGCAATTTATCTGCTTAATTTGTTATGGAGCTGCTATGTTAATCTTTTTAGGTCGATTTTTAATGATC