Homologs in group_774

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03570 FBDBKF_03570 77.0 Morganella morganii S1 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
EHELCC_06965 EHELCC_06965 77.0 Morganella morganii S2 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
NLDBIP_07290 NLDBIP_07290 77.0 Morganella morganii S4 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
LHKJJB_06825 LHKJJB_06825 77.0 Morganella morganii S3 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
HKOGLL_04105 HKOGLL_04105 77.0 Morganella morganii S5 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
F4V73_RS11325 F4V73_RS11325 77.9 Morganella psychrotolerans - 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter

Distribution of the homologs in the orthogroup group_774

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_774

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37619 4.44e-108 312 72 0 207 1 yhhQ Queuosine precursor transporter Escherichia coli (strain K12)
P44908 9.13e-82 246 57 1 216 3 HI_0862 Probable queuosine precursor transporter Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17890
Feature type CDS
Gene -
Product 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter
Location 3931181 - 3931855 (strand: -1)
Length 675 (nucleotides) / 224 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_774
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02592 Putative vitamin uptake transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1738 Translation, ribosomal structure and biogenesis (J) J Queuosine precursor transporter YhhQ, DUF165 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09125 queuosine precursor transporter - -

Protein Sequence

MYRFTSRQKAAALLWLSLFHILIITSSNYLVQLPISIFGFHTTWGAFTFPFIFLATDLTVRIYGAPLARRIITAVMIPALAISYLISTLFFQGSWQGFASLNDFNIMVARIATASFMAYVLGQIMDVSVFNRLRQQQKWWVAPSAAMFFGNFLDTVAFFFIAFYRSTDAFMAANWVEIALVDYTFKLTICMLFFLPAYGVLLNFILRYFFAQENQQQSYAQIRP

Flanking regions ( +/- flanking 50bp)

CATACGTTTTATTGGGTTCCCTCACCCCAATCACTAAAAAGGTACAATTTATGTATAGGTTTACCTCCCGCCAAAAAGCGGCGGCGCTATTATGGCTTTCGTTATTTCATATATTGATAATCACTTCTAGTAACTATCTTGTTCAATTGCCTATTTCTATTTTTGGCTTCCATACCACATGGGGTGCATTTACTTTTCCATTTATTTTCTTAGCGACAGATTTAACTGTTCGTATCTATGGAGCCCCTCTGGCAAGACGCATTATTACTGCCGTTATGATACCGGCATTAGCTATTTCCTACCTAATATCAACACTCTTTTTCCAAGGAAGTTGGCAAGGTTTTGCCTCACTCAATGATTTTAATATCATGGTGGCAAGAATAGCGACAGCAAGCTTTATGGCGTATGTGTTAGGGCAAATTATGGATGTTTCTGTCTTTAATCGTTTAAGACAGCAACAAAAATGGTGGGTAGCACCAAGTGCAGCGATGTTTTTTGGTAATTTCTTAGATACTGTTGCCTTCTTTTTTATTGCCTTTTATCGCAGTACAGATGCGTTTATGGCGGCCAATTGGGTCGAAATAGCGCTCGTGGATTACACTTTTAAATTGACGATTTGTATGCTGTTTTTCTTACCGGCCTATGGCGTATTATTGAACTTTATTTTGCGCTATTTTTTTGCACAAGAAAATCAACAACAAAGCTATGCTCAAATCCGTCCTTAGCTGATTGACTCCCCCAATAAGGCTTTATTCTTTGCACAATAAAGCCTTAG