Homologs in group_844

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03570 FBDBKF_03570 92.8 Morganella morganii S1 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
EHELCC_06965 EHELCC_06965 92.8 Morganella morganii S2 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
NLDBIP_07290 NLDBIP_07290 92.8 Morganella morganii S4 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
LHKJJB_06825 LHKJJB_06825 92.8 Morganella morganii S3 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
HKOGLL_04105 HKOGLL_04105 92.8 Morganella morganii S5 yhhQ 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter
PMI_RS17890 PMI_RS17890 77.9 Proteus mirabilis HI4320 - 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter

Distribution of the homologs in the orthogroup group_844

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_844

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37619 8.33e-110 317 71 0 216 1 yhhQ Queuosine precursor transporter Escherichia coli (strain K12)
P44908 4.81e-81 244 56 1 216 3 HI_0862 Probable queuosine precursor transporter Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P54163 0.000478 43 25 4 179 3 ypdP Probable queuosine precursor transporter Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11325
Feature type CDS
Gene -
Product 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter
Location 407171 - 407839 (strand: -1)
Length 669 (nucleotides) / 222 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_844
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02592 Putative vitamin uptake transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1738 Translation, ribosomal structure and biogenesis (J) J Queuosine precursor transporter YhhQ, DUF165 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09125 queuosine precursor transporter - -

Protein Sequence

MFNLSPRQRLMALTWLSLFHILIITSSNYLVQLPITIFGFHTTWGAFTFPFIFLATDLTVRIYGAPLARRIITSVMIPALAISYVVSALFFQGDWQGFEALTHFNLFVARIAAASFMAYALGQILDVRVFNRLRQNHRWYVAPAAAMFVGNLIDTIAFFFIAFWRSTDPFMAANWVEIALVDYSFKVTICMLFFLPAYGVLLNLILRSFFAQKDDDSLPARH

Flanking regions ( +/- flanking 50bp)

TGCGCTGAGTTTATTGGGTTCCCTAACCCCAACCACCAAAAAGGTACAATATGTTTAATTTATCCCCCCGGCAGCGGCTTATGGCGCTGACCTGGTTATCGCTTTTCCATATTCTGATTATTACCTCCAGTAACTATCTGGTGCAGTTGCCGATCACCATTTTCGGCTTCCACACGACCTGGGGCGCGTTTACCTTTCCCTTTATTTTCCTGGCAACTGACCTGACAGTGCGGATCTACGGCGCACCATTGGCGCGACGAATTATCACATCAGTGATGATACCGGCACTGGCTATTTCCTACGTTGTCTCTGCCCTGTTCTTTCAGGGAGACTGGCAGGGATTTGAAGCGCTGACACATTTCAATCTGTTTGTGGCACGAATTGCCGCCGCCAGTTTTATGGCTTATGCCCTCGGACAAATTCTTGATGTGCGTGTATTCAACCGCCTGCGTCAGAACCACCGCTGGTATGTTGCGCCTGCTGCTGCCATGTTTGTCGGCAACCTGATTGATACCATAGCCTTTTTCTTTATCGCCTTCTGGCGCAGTACCGATCCGTTTATGGCAGCTAACTGGGTGGAAATCGCGCTGGTGGATTACAGCTTTAAAGTGACCATTTGCATGCTCTTTTTCCTGCCGGCCTACGGCGTGCTGCTCAATCTGATCCTGCGCTCGTTTTTTGCACAGAAAGACGACGATTCTCTGCCCGCGCGTCACTAACCTGTCATTTTTCTGACACGCAGGGTGACTATCCTCACTCTGCGCTGTCG