Homologs in group_2216

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16935 FBDBKF_16935 53.3 Morganella morganii S1 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
EHELCC_16655 EHELCC_16655 53.3 Morganella morganii S2 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
NLDBIP_16865 NLDBIP_16865 53.3 Morganella morganii S4 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
LHKJJB_16605 LHKJJB_16605 53.3 Morganella morganii S3 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
HKOGLL_17570 HKOGLL_17570 53.3 Morganella morganii S5 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
F4V73_RS18405 F4V73_RS18405 51.4 Morganella psychrotolerans - SCP2 sterol-binding domain-containing protein

Distribution of the homologs in the orthogroup group_2216

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2216

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADP8 3.47e-57 182 46 0 197 3 ubiJ Ubiquinone biosynthesis accessory factor UbiJ Shigella flexneri
P0ADP7 3.47e-57 182 46 0 197 1 ubiJ Ubiquinone biosynthesis accessory factor UbiJ Escherichia coli (strain K12)
Q9L6M5 2.32e-55 177 45 0 197 3 ubiJ Ubiquinone biosynthesis accessory factor UbiJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17580
Feature type CDS
Gene -
Product SCP2 domain-containing protein
Location 3859033 - 3859674 (strand: 1)
Length 642 (nucleotides) / 213 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2216
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02036 SCP-2 sterol transfer family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3165 Coenzyme transport and metabolism (H) H Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03690 ubiquinone biosynthesis accessory factor UbiJ - -

Protein Sequence

MEKATFSHDIASQVLYPLITASMETALNHVLYQENVLKPARNRLAGKVLALSINEFPQSIYLIFSEQQVDVLTQWNDETDCTIKTKLLTLIKLTDRQKLSELINRGDITIEGDMQVVQNWSALLDMAPWEPAQYLAPYIGDLAAEGLSLAASKGLKLFTTLFGRQKAYLRDALIEEWKTAPSTLETVHFYDEIEQLAQQTAELEKRLSTLEKK

Flanking regions ( +/- flanking 50bp)

CAATATGACTGGAGGTATAGTTGCATTACACAAAGGGTTTAAATTCTAAGATGGAAAAAGCCACTTTTTCTCATGATATTGCTTCTCAAGTGCTCTATCCACTGATAACTGCATCGATGGAAACGGCACTTAATCATGTTTTATATCAGGAAAATGTGCTTAAACCTGCCCGCAATCGCCTTGCGGGCAAAGTCTTGGCGCTTTCTATTAATGAGTTTCCTCAATCTATCTATTTAATTTTCAGCGAACAGCAAGTTGATGTGTTAACTCAATGGAATGATGAGACTGATTGCACGATAAAAACTAAATTATTAACCTTAATTAAACTCACTGACCGACAAAAGTTGTCTGAATTAATTAATCGTGGTGATATTACCATTGAAGGCGATATGCAGGTGGTACAAAACTGGTCTGCCTTGCTGGATATGGCACCCTGGGAGCCTGCGCAATATTTAGCGCCTTATATTGGTGATTTGGCTGCAGAAGGATTATCGCTTGCAGCAAGTAAAGGGCTCAAATTATTCACTACACTATTTGGCCGACAAAAAGCTTATTTAAGAGACGCTTTGATTGAAGAGTGGAAAACCGCCCCCTCAACATTAGAGACTGTCCATTTTTATGATGAAATAGAACAACTGGCACAGCAAACAGCCGAGTTAGAAAAACGGTTAAGCACCTTGGAGAAAAAATAATGCTCCTCAGTGAGTTAAAGCGCCTTTATCATATTATTAAAGTCTTCTTA