Homologs in group_2251

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16935 FBDBKF_16935 83.5 Morganella morganii S1 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
EHELCC_16655 EHELCC_16655 83.5 Morganella morganii S2 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
NLDBIP_16865 NLDBIP_16865 83.5 Morganella morganii S4 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
LHKJJB_16605 LHKJJB_16605 83.5 Morganella morganii S3 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
HKOGLL_17570 HKOGLL_17570 83.5 Morganella morganii S5 ubiJ Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain
PMI_RS17580 PMI_RS17580 51.4 Proteus mirabilis HI4320 - SCP2 domain-containing protein

Distribution of the homologs in the orthogroup group_2251

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2251

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9L6M5 1.02e-59 189 44 0 197 3 ubiJ Ubiquinone biosynthesis accessory factor UbiJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ADP8 1.49e-55 179 42 0 197 3 ubiJ Ubiquinone biosynthesis accessory factor UbiJ Shigella flexneri
P0ADP7 1.49e-55 179 42 0 197 1 ubiJ Ubiquinone biosynthesis accessory factor UbiJ Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18405
Feature type CDS
Gene -
Product SCP2 sterol-binding domain-containing protein
Location 15120 - 15794 (strand: -1)
Length 675 (nucleotides) / 224 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000009
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2251
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02036 SCP-2 sterol transfer family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3165 Coenzyme transport and metabolism (H) H Ubiquinone biosynthesis protein UbiJ, contains SCP2 domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03690 ubiquinone biosynthesis accessory factor UbiJ - -

Protein Sequence

MTDTFAENAPSSVSPHALYPVIAGFLETVLNQLLYREAVLKQARVRLTGKTLALRLTEPEMQFTLIFSEKQLDVISRWEGSADCVLQTRFVTLLKLRDKQQLSALIRSGDVTIDGDMQVIQHFSALLDMAEWDPAHYLAPYLGDVVAQTLTQIAAKGGQFIRNAVCRQKDYLSGAVTREWALAPSALEAAHFCDEVSSAAQAAAELDARLSRLKKRAGTGHETE

Flanking regions ( +/- flanking 50bp)

CAACATGACCGGCGGTATTGTCGCACTGCATAAAGGGTTCAAATTCTGATATGACTGATACGTTTGCTGAAAACGCACCGTCTTCCGTCAGTCCGCACGCGCTTTATCCTGTCATTGCCGGCTTTCTGGAAACCGTACTGAATCAGCTTCTTTACCGGGAAGCTGTCCTGAAACAGGCTCGTGTCCGGCTGACAGGGAAAACGCTGGCTCTCCGGCTGACTGAGCCGGAAATGCAATTCACACTGATTTTCAGTGAAAAACAGCTGGATGTTATCTCCCGTTGGGAAGGTTCGGCAGACTGTGTGCTGCAAACCCGGTTTGTAACCCTTCTGAAACTGAGAGATAAACAACAGCTTTCAGCGCTGATCCGCAGTGGTGATGTCACTATTGACGGAGATATGCAGGTTATTCAGCATTTTTCAGCATTGCTGGATATGGCTGAGTGGGACCCTGCACATTATCTTGCACCGTATCTGGGTGATGTTGTTGCACAAACACTGACACAGATTGCCGCGAAAGGCGGGCAGTTTATCCGCAACGCAGTTTGTCGTCAGAAAGATTATCTGTCAGGTGCGGTGACCCGCGAATGGGCATTAGCACCGTCGGCACTGGAAGCCGCTCATTTCTGTGATGAAGTGTCCTCAGCGGCACAAGCCGCCGCAGAACTTGATGCGCGGCTTTCCCGTCTGAAAAAGAGAGCAGGAACAGGGCATGAGACCGAGTGAGATTAAACGCCTTTATTTTATTATCCGTACTCTCCTTGCTTACGGTCTGG