Homologs in group_277

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08585 FBDBKF_08585 39.1 Morganella morganii S1 - DNA-binding protein
EHELCC_12940 EHELCC_12940 39.1 Morganella morganii S2 - DNA-binding protein
NLDBIP_13280 NLDBIP_13280 39.1 Morganella morganii S4 - DNA-binding protein
LHKJJB_13275 LHKJJB_13275 39.1 Morganella morganii S3 - DNA-binding protein
HKOGLL_11755 HKOGLL_11755 39.1 Morganella morganii S5 - DNA-binding protein
F4V73_RS09810 F4V73_RS09810 39.1 Morganella psychrotolerans - DNA-binding protein
PMI_RS16940 PMI_RS16940 43.5 Proteus mirabilis HI4320 - DNA-binding protein

Distribution of the homologs in the orthogroup group_277

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_277

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P07040 3.9e-12 62 33 2 115 2 repc Repressor c protein Escherichia phage D108

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16935
Feature type CDS
Gene -
Product DNA-binding protein
Location 3729806 - 3730153 (strand: 1)
Length 348 (nucleotides) / 115 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_277
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF02316 Mu DNA-binding domain

Protein Sequence

MKKEWYTAMELTGIGGLPKSPQGVNAKAKRESWLKQKRTNKQGNGVEYHYSCLPEETLIALELYEPLAHYKLNKEEPLVIWVKAFQQLNDGEQKTVTELILRDGIRSFLEKIVKD

Flanking regions ( +/- flanking 50bp)

TTTCTTAATAATTTCTTTTTTGAAGTTGATAACAATTTTAGAGAAACGTAATGAAAAAAGAGTGGTATACGGCAATGGAATTGACGGGTATAGGTGGATTACCTAAATCACCACAAGGTGTAAATGCAAAAGCTAAACGTGAATCTTGGTTAAAACAAAAGAGAACTAATAAACAAGGAAATGGCGTTGAATATCATTACTCTTGTTTACCAGAAGAAACTTTAATTGCTCTGGAGCTTTATGAACCATTAGCACATTACAAACTAAATAAAGAGGAGCCACTCGTTATCTGGGTGAAAGCATTCCAACAACTTAATGATGGTGAACAAAAAACAGTAACAGAGCTGATCTTGCGGGATGGTATTAGAAGTTTTTTAGAAAAGATCGTCAAAGATTAAGCGACTTTAAAGAACGCGCTATTGCGTTATCCGCAACCGATATCTGACTA