Homologs in group_3872

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS19205 F4V73_RS19205 52.3 Morganella psychrotolerans - type II toxin-antitoxin system YafQ family toxin

Distribution of the homologs in the orthogroup group_3872

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3872

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q47149 2.21e-29 103 55 1 86 1 yafQ mRNA interferase toxin YafQ Escherichia coli (strain K12)
A0A140NAP5 5.2e-29 102 55 1 86 1 yafQ mRNA interferase toxin YafQ Escherichia coli (strain B / BL21-DE3)
P44041 4.14e-09 52 37 2 89 3 yafQ Putative toxin YafQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16445
Feature type CDS
Gene -
Product type II toxin-antitoxin system YafQ family toxin
Location 3626837 - 3627097 (strand: -1)
Length 261 (nucleotides) / 86 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3872
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF15738 Bacterial toxin of type II toxin-antitoxin system, YafQ

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3041 Translation, ribosomal structure and biogenesis (J)
Defense mechanisms (V)		 JV mRNA-degrading endonuclease YafQ (mRNA interferase), toxin component of the YafQ-DinJ toxin-antitoxin module

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19157 mRNA interferase YafQ [EC:3.1.-.-] - -

Protein Sequence

MSYSGQFKKDLKLAEKRGKDINKLKEIILLLVQGKRLPAQLKDHPLTGNWKPRRDLHIEPDWLLIYKIDNDTVHFDRTGSHSDLFK

Flanking regions ( +/- flanking 50bp)

CTGAAGATGCCCATGATTTATTCAAAAAATTGGATATCTAAACGCGAAAAGTGAGTTATTCAGGACAATTTAAAAAAGACTTAAAACTCGCAGAAAAGCGAGGAAAGGATATTAATAAACTAAAAGAGATTATATTACTATTAGTGCAAGGAAAACGACTACCTGCTCAATTGAAAGATCATCCATTAACAGGAAACTGGAAGCCTCGTCGAGATCTTCATATCGAACCTGATTGGCTACTTATTTATAAAATAGACAATGATACTGTTCATTTTGACAGAACTGGCTCACATTCTGATTTATTTAAATAAAAACCACATATCAAATTGATAGATATGTGGTTTTATCTTTTTAAAATATA