Homologs in group_2404

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19105 FBDBKF_19105 66.7 Morganella morganii S1 arfA Stalled ribosome alternative rescue factor ArfA
EHELCC_18850 EHELCC_18850 66.7 Morganella morganii S2 arfA Stalled ribosome alternative rescue factor ArfA
NLDBIP_18865 NLDBIP_18865 66.7 Morganella morganii S4 arfA Stalled ribosome alternative rescue factor ArfA
LHKJJB_18720 LHKJJB_18720 66.7 Morganella morganii S3 arfA Stalled ribosome alternative rescue factor ArfA
HKOGLL_18455 HKOGLL_18455 66.7 Morganella morganii S5 arfA Stalled ribosome alternative rescue factor ArfA
F4V73_RS19060 F4V73_RS19060 62.1 Morganella psychrotolerans - ribosome alternative rescue factor ArfA

Distribution of the homologs in the orthogroup group_2404

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2404

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36675 5.2e-27 95 67 0 65 1 arfA Alternative ribosome-rescue factor A Escherichia coli (strain K12)
P44588 2.11e-16 68 64 1 56 3 arfA Alternative ribosome-rescue factor A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16285
Feature type CDS
Gene -
Product alternative ribosome-rescue factor A
Location 3596802 - 3597005 (strand: 1)
Length 204 (nucleotides) / 67 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2404
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03889 Alternative ribosome-rescue factor A

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3036 Translation, ribosomal structure and biogenesis (J) J Stalled ribosome alternative rescue factor ArfA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09890 alternative ribosome-rescue factor - -

Protein Sequence

MSSKYQHQKGVIKDNALAALVHDPLFRQRVEKNKKGKGSYMRKAKHNKKGNWEASDNKYFQLLSLAF

Flanking regions ( +/- flanking 50bp)

GAAGATTGTTGTTCTATGCTTTATGTTCTTTAATAATTTAAGAGGTTTTTATGTCTAGCAAATATCAGCACCAAAAAGGTGTGATCAAAGATAATGCGTTAGCTGCACTTGTTCATGATCCTTTATTTAGACAACGGGTAGAAAAAAATAAGAAAGGCAAAGGCAGCTATATGAGAAAGGCAAAACATAATAAGAAAGGTAACTGGGAGGCCAGTGATAACAAATATTTTCAATTGTTATCACTGGCCTTTTAGTTTTTATTTTTGCTGATTTTTTAATAGATCACGGATTTCTGTTAATAAAG