Homologs in group_1754

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12220 FBDBKF_12220 93.3 Morganella morganii S1 metJ met regulon transcriptional regulator MetJ
EHELCC_14085 EHELCC_14085 93.3 Morganella morganii S2 metJ met regulon transcriptional regulator MetJ
NLDBIP_15180 NLDBIP_15180 93.3 Morganella morganii S4 metJ met regulon transcriptional regulator MetJ
LHKJJB_15430 LHKJJB_15430 93.3 Morganella morganii S3 metJ met regulon transcriptional regulator MetJ
HKOGLL_14550 HKOGLL_14550 93.3 Morganella morganii S5 metJ met regulon transcriptional regulator MetJ
F4V73_RS17050 F4V73_RS17050 93.3 Morganella psychrotolerans metJ met regulon transcriptional regulator MetJ

Distribution of the homologs in the orthogroup group_1754

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1754

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F178 6.35e-75 219 100 0 105 3 metJ Met repressor Proteus mirabilis (strain HI4320)
B5XZ31 6.17e-70 206 92 0 105 3 metJ Met repressor Klebsiella pneumoniae (strain 342)
A8AKY5 1.59e-69 206 92 0 105 3 metJ Met repressor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7MYC7 1.79e-69 205 90 0 105 3 metJ Met repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7ML79 1.79e-69 205 91 0 105 3 metJ Met repressor Cronobacter sakazakii (strain ATCC BAA-894)
C6DHN7 1.85e-69 205 91 0 105 3 metJ Met repressor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZA0 1.85e-69 205 91 0 105 3 metJ Met repressor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TGC7 2.23e-69 205 91 0 105 3 metJ Met repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8Z2Z4 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella typhi
B4TPW1 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella schwarzengrund (strain CVM19633)
B5BJL6 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella paratyphi A (strain AKU_12601)
C0Q452 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella paratyphi C (strain RKS4594)
A9MZJ3 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK48 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0U7 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella newport (strain SL254)
B4TCN8 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella heidelberg (strain SL476)
B5RF72 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXM8 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella enteritidis PT4 (strain P125109)
B5FPU9 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella dublin (strain CT_02021853)
Q57HB6 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella choleraesuis (strain SC-B67)
B5F0T1 2.54e-69 205 91 0 105 3 metJ Met repressor Salmonella agona (strain SL483)
B2VI92 2.66e-69 205 92 0 105 3 metJ Met repressor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GL90 3.17e-69 205 91 0 105 3 metJ Met repressor Serratia proteamaculans (strain 568)
P06203 3.74e-69 204 91 0 105 3 metJ Met repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B1JQ68 3.78e-69 204 91 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G78 3.78e-69 204 91 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
B2JZD3 3.78e-69 204 91 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FCZ2 3.78e-69 204 91 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JI14 3.78e-69 204 91 0 105 3 metJ Met repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WG61 4.31e-69 204 91 0 105 3 metJ Met repressor Enterobacter sp. (strain 638)
A4TS76 1.31e-68 203 90 0 105 3 metJ Met repressor Yersinia pestis (strain Pestoides F)
Q1CD62 1.31e-68 203 90 0 105 3 metJ Met repressor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4I4 1.31e-68 203 90 0 105 3 metJ Met repressor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI8 1.31e-68 203 90 0 105 3 metJ Met repressor Yersinia pestis
Q1CBE1 1.31e-68 203 90 0 105 3 metJ Met repressor Yersinia pestis bv. Antiqua (strain Antiqua)
Q3YV35 1.44e-68 203 90 0 105 3 metJ Met repressor Shigella sonnei (strain Ss046)
P0A8U9 1.44e-68 203 90 0 105 3 metJ Met repressor Shigella flexneri
Q32AD6 1.44e-68 203 90 0 105 3 metJ Met repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31U49 1.44e-68 203 90 0 105 3 metJ Met repressor Shigella boydii serotype 4 (strain Sb227)
B2TWD5 1.44e-68 203 90 0 105 3 metJ Met repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUR5 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNP3 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli (strain SMS-3-5 / SECEC)
B6I4T6 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli (strain SE11)
P0A8U6 1.44e-68 203 90 0 105 1 metJ Met repressor Escherichia coli (strain K12)
B1IVD9 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8U7 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAC6 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A746 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O9:H4 (strain HS)
B1XBA4 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli (strain K12 / DH10B)
C5A0A5 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Z3 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O8 (strain IAI1)
B5Z040 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8U8 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O157:H7
B7LA39 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli (strain 55989 / EAEC)
B7UNQ8 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUF7 1.44e-68 203 90 0 105 3 metJ Met repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2NQY6 7e-68 201 88 0 105 3 metJ Met repressor Sodalis glossinidius (strain morsitans)
C4K6P9 6.07e-64 191 82 0 105 3 metJ Met repressor Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q9CLE7 8.09e-63 189 81 0 105 3 metJ Met repressor Pasteurella multocida (strain Pm70)
Q4QNP9 1.58e-62 188 81 0 105 3 metJ Met repressor Haemophilus influenzae (strain 86-028NP)
P44618 3.48e-62 187 81 0 105 3 metJ Met repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAJ6 3.48e-62 187 81 0 105 3 metJ Met repressor Haemophilus influenzae (strain PittEE)
B0BTJ8 4.84e-62 187 80 0 105 3 metJ Met repressor Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2Y8 4.84e-62 187 80 0 105 3 metJ Met repressor Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3L1 4.84e-62 187 80 0 105 3 metJ Met repressor Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VLD8 1.09e-61 186 81 0 105 3 metJ Met repressor Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0USK7 1.37e-61 186 80 0 105 3 metJ Met repressor Histophilus somni (strain 2336)
Q0I283 1.37e-61 186 80 0 105 3 metJ Met repressor Histophilus somni (strain 129Pt)
B8F882 2.04e-61 185 80 0 105 3 metJ Met repressor Glaesserella parasuis serovar 5 (strain SH0165)
Q7MH63 1.44e-60 183 80 0 104 3 metJ Met repressor Vibrio vulnificus (strain YJ016)
Q8DCN7 1.44e-60 183 80 0 104 3 metJ Met repressor Vibrio vulnificus (strain CMCP6)
Q87L49 1.22e-59 181 79 0 104 3 metJ Met repressor Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MXB2 1.22e-59 181 79 0 104 3 metJ Met repressor Vibrio campbellii (strain ATCC BAA-1116)
Q7VN90 1.88e-59 180 79 0 105 3 metJ Met repressor Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C3LSB1 2.29e-59 180 79 0 104 3 metJ Met repressor Vibrio cholerae serotype O1 (strain M66-2)
Q9KNP9 2.29e-59 180 79 0 104 3 metJ Met repressor Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4W0 2.29e-59 180 79 0 104 3 metJ Met repressor Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VLM0 2.66e-59 180 78 0 104 3 metJ Met repressor Vibrio atlanticus (strain LGP32)
Q8EA52 6.97e-56 171 78 0 104 3 metJ Met repressor Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15935
Feature type CDS
Gene metJ
Product met regulon transcriptional regulator MetJ
Location 3536773 - 3537090 (strand: -1)
Length 318 (nucleotides) / 105 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1754
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01340 Met Apo-repressor, MetJ

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3060 Transcription (K)
Amino acid transport and metabolism (E)		 KE Transcriptional regulator MetJ (met regulon)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03764 MetJ family transcriptional regulator, methionine regulon repressor - -

Protein Sequence

MAEWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLKHATNSELLCEAFLHAFTGQPLPNDEDLRKERNDEIPEEAKEIMRQRGVDPETWEY

Flanking regions ( +/- flanking 50bp)

GCATCAACCCTAAACTGGCTTCAACTAAATGATATTAATTAAGGTAATCCATGGCTGAATGGAACGGTGAATATATCAGCCCTTACGCTGAGCATGGTAAAAAAAGCGAACAAGTCAAAAAAATTACAGTTTCAATCCCATTGAAAGTGCTAAAAATTTTGACAGATGAGCGCACTCGTCGTCAGGTCAATAACCTAAAACATGCCACCAATAGTGAATTATTGTGTGAAGCATTTTTACACGCATTTACCGGACAGCCTCTCCCCAATGATGAAGACTTACGCAAAGAGCGTAACGATGAAATCCCTGAAGAGGCAAAAGAAATAATGCGCCAGCGGGGTGTTGATCCCGAGACTTGGGAATATTGATCAGAAATTATTTTTGATAGCAAAAATATAACCAGAAGCCCAAAGCCAAC