Homologs in group_1792

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12220 FBDBKF_12220 100.0 Morganella morganii S1 metJ met regulon transcriptional regulator MetJ
EHELCC_14085 EHELCC_14085 100.0 Morganella morganii S2 metJ met regulon transcriptional regulator MetJ
NLDBIP_15180 NLDBIP_15180 100.0 Morganella morganii S4 metJ met regulon transcriptional regulator MetJ
HKOGLL_14550 HKOGLL_14550 100.0 Morganella morganii S5 metJ met regulon transcriptional regulator MetJ
F4V73_RS17050 F4V73_RS17050 100.0 Morganella psychrotolerans metJ met regulon transcriptional regulator MetJ
PMI_RS15935 PMI_RS15935 93.3 Proteus mirabilis HI4320 metJ met regulon transcriptional regulator MetJ

Distribution of the homologs in the orthogroup group_1792

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1792

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7ML79 2.95e-71 210 95 0 105 3 metJ Met repressor Cronobacter sakazakii (strain ATCC BAA-894)
B5XZ31 9.87e-71 209 93 0 105 3 metJ Met repressor Klebsiella pneumoniae (strain 342)
Q8Z2Z4 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella typhi
B4TPW1 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella schwarzengrund (strain CVM19633)
B5BJL6 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella paratyphi A (strain AKU_12601)
C0Q452 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella paratyphi C (strain RKS4594)
A9MZJ3 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK48 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0U7 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella newport (strain SL254)
B4TCN8 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella heidelberg (strain SL476)
B5RF72 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXM8 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella enteritidis PT4 (strain P125109)
B5FPU9 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella dublin (strain CT_02021853)
Q57HB6 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella choleraesuis (strain SC-B67)
B5F0T1 1.45e-70 208 93 0 105 3 metJ Met repressor Salmonella agona (strain SL483)
P06203 2.48e-70 207 93 0 105 3 metJ Met repressor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4F178 2.51e-70 207 93 0 105 3 metJ Met repressor Proteus mirabilis (strain HI4320)
B2VI92 2.74e-70 207 95 0 105 3 metJ Met repressor Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DHN7 3.3e-70 207 92 0 105 3 metJ Met repressor Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZA0 3.3e-70 207 92 0 105 3 metJ Met repressor Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YV35 6.04e-70 206 92 0 105 3 metJ Met repressor Shigella sonnei (strain Ss046)
P0A8U9 6.04e-70 206 92 0 105 3 metJ Met repressor Shigella flexneri
Q32AD6 6.04e-70 206 92 0 105 3 metJ Met repressor Shigella dysenteriae serotype 1 (strain Sd197)
Q31U49 6.04e-70 206 92 0 105 3 metJ Met repressor Shigella boydii serotype 4 (strain Sb227)
B2TWD5 6.04e-70 206 92 0 105 3 metJ Met repressor Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUR5 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNP3 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli (strain SMS-3-5 / SECEC)
B6I4T6 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli (strain SE11)
P0A8U6 6.04e-70 206 92 0 105 1 metJ Met repressor Escherichia coli (strain K12)
B1IVD9 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8U7 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAC6 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A746 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O9:H4 (strain HS)
B1XBA4 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli (strain K12 / DH10B)
C5A0A5 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Z3 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O8 (strain IAI1)
B5Z040 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8U8 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O157:H7
B7LA39 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli (strain 55989 / EAEC)
B7UNQ8 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUF7 6.04e-70 206 92 0 105 3 metJ Met repressor Escherichia coli O139:H28 (strain E24377A / ETEC)
A8GL90 7.2e-70 206 92 0 105 3 metJ Met repressor Serratia proteamaculans (strain 568)
A6TGC7 7.2e-70 206 92 0 105 3 metJ Met repressor Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B1JQ68 8.3e-70 206 92 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G78 8.3e-70 206 92 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype I (strain IP32953)
B2JZD3 8.3e-70 206 92 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FCZ2 8.3e-70 206 92 0 105 3 metJ Met repressor Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JI14 8.3e-70 206 92 0 105 3 metJ Met repressor Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WG61 1.38e-69 206 92 0 105 3 metJ Met repressor Enterobacter sp. (strain 638)
Q2NQY6 1.49e-69 206 91 0 105 3 metJ Met repressor Sodalis glossinidius (strain morsitans)
A4TS76 2.93e-69 205 91 0 105 3 metJ Met repressor Yersinia pestis (strain Pestoides F)
Q1CD62 2.93e-69 205 91 0 105 3 metJ Met repressor Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4I4 2.93e-69 205 91 0 105 3 metJ Met repressor Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI8 2.93e-69 205 91 0 105 3 metJ Met repressor Yersinia pestis
Q1CBE1 2.93e-69 205 91 0 105 3 metJ Met repressor Yersinia pestis bv. Antiqua (strain Antiqua)
Q7MYC7 3e-69 205 91 0 105 3 metJ Met repressor Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8AKY5 5.79e-69 204 92 0 105 3 metJ Met repressor Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C4K6P9 1.85e-64 192 83 0 105 3 metJ Met repressor Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0BTJ8 4.52e-63 189 83 0 105 3 metJ Met repressor Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2Y8 4.52e-63 189 83 0 105 3 metJ Met repressor Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3L1 4.52e-63 189 83 0 105 3 metJ Met repressor Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F882 1.36e-62 188 83 0 105 3 metJ Met repressor Glaesserella parasuis serovar 5 (strain SH0165)
B0USK7 1.77e-61 185 81 0 105 3 metJ Met repressor Histophilus somni (strain 2336)
Q0I283 1.77e-61 185 81 0 105 3 metJ Met repressor Histophilus somni (strain 129Pt)
A6VLD8 2.18e-61 185 81 0 105 3 metJ Met repressor Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CLE7 2.28e-61 185 80 0 105 3 metJ Met repressor Pasteurella multocida (strain Pm70)
Q4QNP9 2.52e-60 182 80 0 105 3 metJ Met repressor Haemophilus influenzae (strain 86-028NP)
P44618 3.86e-60 182 80 0 105 3 metJ Met repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAJ6 3.86e-60 182 80 0 105 3 metJ Met repressor Haemophilus influenzae (strain PittEE)
Q7VN90 1.2e-59 181 80 0 105 3 metJ Met repressor Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MH63 1.63e-58 178 78 0 104 3 metJ Met repressor Vibrio vulnificus (strain YJ016)
Q8DCN7 1.63e-58 178 78 0 104 3 metJ Met repressor Vibrio vulnificus (strain CMCP6)
Q87L49 1.04e-57 176 77 0 104 3 metJ Met repressor Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MXB2 1.04e-57 176 77 0 104 3 metJ Met repressor Vibrio campbellii (strain ATCC BAA-1116)
C3LSB1 2.03e-57 175 77 0 104 3 metJ Met repressor Vibrio cholerae serotype O1 (strain M66-2)
Q9KNP9 2.03e-57 175 77 0 104 3 metJ Met repressor Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4W0 2.03e-57 175 77 0 104 3 metJ Met repressor Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VLM0 2.22e-57 175 76 0 104 3 metJ Met repressor Vibrio atlanticus (strain LGP32)
Q8EA52 5.54e-56 171 79 1 104 3 metJ Met repressor Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15430
Feature type CDS
Gene metJ
Product met regulon transcriptional regulator MetJ
Location 104335 - 104652 (strand: 1)
Length 318 (nucleotides) / 105 (amino acids)
In genomic island -

Contig

Accession ZDB_373
Length 137108 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1792
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01340 Met Apo-repressor, MetJ

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3060 Transcription (K)
Amino acid transport and metabolism (E)
KE Transcriptional regulator MetJ (met regulon)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03764 MetJ family transcriptional regulator, methionine regulon repressor - -

Protein Sequence

MAEWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDDDLRKERSDEIPEVAKEIMRQHGVDPDTWEY

Flanking regions ( +/- flanking 50bp)

TTTTCTGTGCCCGGCTCCTCCTCAAACTGACTAAGATAACAAGGTAATCCATGGCTGAATGGAACGGCGAATATATCAGCCCTTATGCTGAGCATGGCAAAAAAAGTGAGCAGGTAAAGAAGATTACAGTTTCTATCCCGTTGAAAGTGCTTAAAATTTTAACGGATGAGCGCACGCGCCGCCAGGTGAATAACCTGCGTCATGCCACCAATAGCGAACTGTTATGTGAAGCATTTCTGCATGCTTTTACCGGACAGCCACTGCCCGATGATGATGATCTGCGCAAAGAACGCAGTGATGAAATCCCGGAAGTGGCGAAAGAAATTATGCGCCAGCATGGGGTCGACCCGGATACGTGGGAATATTGAGTTTTATCCGCGTGTTATACGACTTCTCAACCCGGAAACAGACATAAAAA