Homologs in group_1772

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12330 FBDBKF_12330 90.5 Morganella morganii S1 cpxR envelope stress response regulator transcription factor CpxR
EHELCC_13975 EHELCC_13975 90.5 Morganella morganii S2 cpxR envelope stress response regulator transcription factor CpxR
NLDBIP_15070 NLDBIP_15070 90.5 Morganella morganii S4 cpxR envelope stress response regulator transcription factor CpxR
LHKJJB_15540 LHKJJB_15540 90.5 Morganella morganii S3 cpxR envelope stress response regulator transcription factor CpxR
HKOGLL_14660 HKOGLL_14660 90.5 Morganella morganii S5 cpxR envelope stress response regulator transcription factor CpxR
F4V73_RS17160 F4V73_RS17160 90.9 Morganella psychrotolerans cpxR envelope stress response regulator transcription factor CpxR

Distribution of the homologs in the orthogroup group_1772

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1772

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE90 5.41e-135 381 86 0 232 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 5.41e-135 381 86 0 232 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 5.41e-135 381 86 0 232 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
A0A0H3GGB5 1.95e-134 380 86 0 232 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P44895 9.6e-79 239 59 1 230 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7A216 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 7.36e-55 178 40 2 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 7.36e-55 178 40 2 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 7.36e-55 178 40 2 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 7.36e-55 178 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P37478 2.42e-54 177 40 2 227 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q4LAJ9 7.11e-54 176 40 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q4A160 3.01e-53 174 39 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CQK0 3.24e-53 174 39 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 3.24e-53 174 39 2 227 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P13792 4.21e-53 174 43 4 229 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q8DPL7 4.45e-52 171 40 3 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 4.45e-52 171 40 3 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 4.45e-52 171 40 3 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O78428 3.51e-51 169 43 4 235 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
A0A4P7TS68 1.01e-49 165 40 3 230 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.01e-49 165 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.01e-49 165 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.01e-49 165 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.01e-49 165 40 3 230 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.01e-49 165 40 3 230 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.01e-49 165 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.01e-49 165 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P48259 3.8e-47 159 42 4 231 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q9TLQ4 5.04e-47 159 39 2 233 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P51358 9.65e-46 155 40 4 232 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 1.21e-45 155 40 4 232 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P9WGL9 1.87e-45 154 38 2 227 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 1.87e-45 154 38 2 227 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 1.87e-45 154 38 2 227 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P28835 2.37e-45 154 40 3 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P94413 2.1e-44 151 35 4 226 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q06239 1.09e-43 149 36 4 227 3 vanR Regulatory protein VanR Enterococcus faecium
P42244 1.28e-43 149 34 2 223 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q9F868 1.83e-43 149 37 2 227 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45607 1.95e-43 149 39 4 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
L7N689 2.39e-43 149 39 4 228 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P35163 3.24e-43 149 37 2 226 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P69228 3.77e-43 148 37 2 225 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 3.77e-43 148 37 2 225 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0C001 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 4.37e-43 147 38 4 229 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 4.37e-43 147 38 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q7A0U4 4.75e-43 148 36 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 4.75e-43 148 36 2 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 4.75e-43 148 36 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 4.75e-43 148 36 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 4.75e-43 148 36 2 227 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 4.75e-43 148 36 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 4.75e-43 148 36 2 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 4.75e-43 148 36 2 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P28257 9.8e-43 148 40 4 234 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P0AFJ5 1.07e-42 147 39 4 228 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.07e-42 147 39 4 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 1.36e-42 147 39 4 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
A1TEL7 1.42e-42 147 38 5 229 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1B3X8 1.91e-42 146 40 5 229 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.91e-42 146 40 5 229 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.91e-42 146 40 5 229 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P31079 2.05e-42 146 38 4 232 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A1KHB7 5.97e-42 145 39 5 229 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 5.97e-42 145 39 5 229 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 1.19e-41 144 39 5 229 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.19e-41 144 39 5 229 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.19e-41 144 39 5 229 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A0PWB4 1.43e-41 144 38 5 229 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q742C1 1.47e-41 144 39 5 229 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.47e-41 144 39 5 229 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P45605 2.12e-41 144 38 4 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q99U73 4.23e-41 142 37 4 229 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P39663 5.82e-41 143 37 4 236 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
G3XCY6 8.03e-41 142 37 5 235 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q07783 8.25e-41 142 37 4 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q9CD68 9.82e-41 142 39 5 229 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q49XM7 1.08e-40 141 38 5 230 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P50350 2.03e-40 141 38 3 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P23620 2.26e-40 141 36 4 227 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0R3I8 2.33e-40 141 39 5 229 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9HV32 1.73e-39 138 40 4 226 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P54443 2.49e-39 138 35 2 226 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
Q4L6C6 5.34e-39 137 36 5 230 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q8CQ17 3.05e-38 135 35 4 228 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 3.05e-38 135 35 4 228 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q55890 3.46e-38 135 38 3 232 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P50351 3.69e-38 135 38 2 235 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P32040 4.29e-38 135 38 6 234 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P94504 9.92e-38 134 34 6 229 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q49ZT8 1.24e-37 134 34 3 227 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P54884 1.29e-37 133 38 2 198 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q31S42 1.49e-37 134 38 3 230 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q70FH0 2.29e-37 133 37 4 228 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q7A1J1 4.65e-37 132 33 2 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 4.65e-37 132 33 2 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 4.65e-37 132 33 2 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 4.65e-37 132 33 2 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 4.65e-37 132 33 2 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 4.65e-37 132 33 2 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 4.65e-37 132 33 2 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 4.65e-37 132 33 2 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 4.65e-37 132 33 2 227 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 4.65e-37 132 33 2 227 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
O34903 5.7e-37 132 36 4 227 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q2YZ24 7.88e-37 132 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A6QJK3 1.16e-36 131 33 3 227 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.16e-36 131 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
O32192 1.7e-36 131 36 4 236 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q6GE73 2.59e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q7A039 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 2.8e-36 130 33 3 227 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P44918 4.64e-36 130 34 3 226 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9Q4 1.4e-35 129 34 4 228 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 1.4e-35 129 34 4 228 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 1.4e-35 129 34 4 228 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 1.4e-35 129 34 4 228 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q82EB1 1.96e-35 128 35 4 230 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P76340 2.09e-35 128 35 4 234 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
P08368 2.84e-35 128 35 4 228 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P52076 4.89e-35 127 36 4 228 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q9I0I1 4.93e-35 127 36 5 233 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6WZ81 5.9e-35 127 33 4 230 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9ZEP4 7.61e-35 127 36 4 229 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5HLN2 7.85e-35 126 33 3 227 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7D9K0 8.79e-35 127 37 4 226 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 8.79e-35 127 37 4 226 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q5HPC3 1.09e-34 126 35 4 229 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q52990 1.16e-34 126 37 4 232 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q44929 1.18e-34 126 34 2 229 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P45189 1.24e-34 126 32 4 231 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8FZ93 1.63e-34 126 33 4 230 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.63e-34 126 33 4 230 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.63e-34 126 33 4 230 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.63e-34 126 33 4 230 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.63e-34 126 33 4 230 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.63e-34 126 33 4 230 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.63e-34 126 33 4 230 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.63e-34 126 33 4 230 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q8CP82 1.68e-34 125 35 4 229 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9HUI2 1.96e-34 126 34 4 236 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8CN92 2.52e-34 125 33 3 227 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0DMK7 2.61e-34 125 35 3 227 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 2.61e-34 125 35 3 227 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q8DN02 2.87e-34 125 35 6 231 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 2.87e-34 125 35 6 231 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q04803 4.17e-34 127 36 2 228 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8XBS3 6.13e-34 124 36 4 228 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q01473 8.5e-34 131 36 3 228 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 5.89e-10 62 33 3 125 3 rcaC Protein RcaC Microchaete diplosiphon
Q44006 9.26e-34 124 34 3 227 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q93CB8 1.15e-33 124 35 2 226 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM1 1.29e-33 124 39 5 214 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.29e-33 124 39 5 214 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.29e-33 124 39 5 214 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM7 1.42e-33 123 35 2 226 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.42e-33 123 35 2 226 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.42e-33 123 35 2 226 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q02540 2.06e-33 123 38 5 228 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q50136 2.18e-33 123 39 6 215 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q9CCJ2 2.61e-33 122 35 2 226 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q9KM23 2.66e-33 123 36 3 225 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P36556 3.83e-33 122 36 5 234 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66795 3.91e-33 122 36 4 228 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 3.91e-33 122 36 4 228 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q47744 5.59e-33 122 35 3 225 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q04942 7.3e-33 121 37 3 227 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9AE24 7.76e-33 122 32 4 230 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P30843 8.02e-33 121 37 5 230 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P0A4H8 1.82e-32 120 35 6 231 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.82e-32 120 35 6 231 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0QTK2 2.42e-32 120 34 2 226 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45337 6.7e-32 119 33 6 233 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4L8L9 6.71e-32 119 32 3 231 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P0CL17 9.64e-32 119 39 9 232 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 9.64e-32 119 39 9 232 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
B8H358 1.33e-31 118 30 4 230 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.33e-31 118 30 4 230 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P38684 1.66e-31 118 31 4 231 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P0A4I2 2e-31 117 34 4 226 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 2e-31 117 34 4 226 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A4I0 4.34e-31 117 34 3 208 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 4.34e-31 117 34 3 208 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
Q2FWH6 4.49e-31 117 33 4 229 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q47456 5.35e-31 117 33 5 231 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q07597 9.31e-31 116 32 5 235 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
P58357 1.31e-30 115 31 5 233 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P9WGN1 1.86e-30 115 31 2 227 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 1.86e-30 115 31 2 227 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P42421 2.43e-30 115 31 4 227 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q8GP20 5.57e-30 114 35 5 229 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P0ACZ8 5.66e-30 114 35 5 229 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 5.66e-30 114 35 5 229 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 5.66e-30 114 35 5 229 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q9I4F9 7.26e-30 114 35 4 228 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O06978 2.34e-29 112 30 3 227 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q9ZHD3 2.6e-29 112 36 5 230 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P52108 2.64e-29 112 33 4 235 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
P21866 5.15e-27 106 31 3 229 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q8CQ37 5.9e-27 106 30 4 228 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 5.9e-27 106 30 4 228 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O69730 8.07e-27 106 33 4 227 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P23836 1.56e-26 105 31 4 228 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q9K621 2.71e-26 104 29 3 228 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O24973 4.1e-26 104 33 5 228 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q55933 4.24e-26 104 35 7 237 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q83RR0 4.84e-26 103 30 4 228 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 4.84e-26 103 30 4 228 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P13359 7.63e-26 103 31 4 231 3 virG Regulatory protein VirG Rhizobium rhizogenes
Q8X738 1.27e-25 102 30 4 228 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q932F1 1.49e-25 102 28 4 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YSS2 2.15e-25 102 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8Z7H2 2.72e-25 102 30 4 230 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
A8Z181 3.35e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 3.35e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 3.35e-25 101 28 4 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 3.35e-25 101 28 4 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 3.35e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q7A1L2 4.7e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 4.7e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 4.7e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 4.7e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 4.7e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 4.7e-25 101 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P0DM78 4.91e-25 101 30 4 230 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 4.91e-25 101 30 4 230 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 4.91e-25 101 30 4 230 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 4.91e-25 101 30 4 230 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 4.91e-25 101 30 4 230 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6GJ11 7.89e-25 100 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q49VK3 1.35e-24 100 28 3 225 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q57QC3 2.13e-24 99 30 4 230 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P33112 2.5e-24 99 32 3 226 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q4L481 3.45e-24 99 28 5 229 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
P62722 5.59e-23 97 33 5 231 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q44444 1.41e-22 95 33 5 231 3 virG Regulatory protein VirG Rhizobium radiobacter
O34951 2.22e-22 94 28 3 228 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P07545 2.53e-22 94 31 5 232 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1XDE4 3.63e-22 93 35 4 182 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P55701 6.52e-22 93 31 7 229 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O31432 4.57e-19 85 25 8 235 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P48359 2.69e-18 83 36 4 164 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P46384 1.07e-17 79 36 2 115 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O25918 1.29e-17 81 29 6 227 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
T2KMF4 7.14e-16 79 37 3 116 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P72781 1.21e-15 76 39 4 124 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P51343 1.15e-14 73 35 4 148 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
B8GZM2 1.83e-14 75 38 2 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 1.83e-14 75 38 2 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P24072 1.86e-14 70 40 4 112 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q06065 4.28e-14 74 39 2 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P52929 6.8e-14 71 38 4 119 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P52934 6.99e-14 72 32 6 169 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
P43501 7.46e-14 68 35 2 119 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9APD9 1.29e-13 72 40 2 126 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q1IRH0 1.32e-13 72 30 9 208 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P14375 2.1e-13 72 39 2 118 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8X613 3.34e-13 71 39 2 118 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P06534 4.06e-13 70 36 5 137 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q54SP4 4.56e-13 71 38 3 112 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 1.4e-05 49 31 3 129 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P40138 5.08e-13 70 36 3 127 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P52931 6.21e-13 68 36 6 137 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P52932 6.67e-13 68 38 4 118 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
P0AFB8 2.39e-12 68 39 6 126 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.39e-12 68 39 6 126 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P0A4I4 2.51e-12 67 35 4 123 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 2.51e-12 67 35 4 123 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P41789 2.83e-12 68 39 6 126 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52928 3.12e-12 67 35 3 125 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
Q8Z333 3.18e-12 68 41 2 102 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 3.3e-12 68 41 2 102 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEV3 3.61e-12 68 40 3 112 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 3.61e-12 68 40 3 112 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 3.61e-12 68 40 3 112 3 rssB Regulator of RpoS Escherichia coli O157:H7
P28787 5.99e-12 67 38 8 150 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q54YZ9 6.35e-12 68 38 3 131 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q9KSB1 1.18e-11 67 36 3 117 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P03029 1.22e-11 67 40 6 124 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P51586 1.44e-11 63 39 2 109 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P23221 1.53e-11 64 32 2 125 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P26487 1.65e-11 64 34 4 132 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9WY30 2.24e-11 65 32 2 114 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P96602 2.26e-11 64 33 5 141 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P71403 2.57e-11 62 31 3 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
O05251 3.06e-11 64 44 6 107 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q9ZM64 3.92e-11 62 31 3 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P96686 5.26e-11 63 33 2 119 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P58253 5.77e-11 64 34 4 130 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q86AT9 6.65e-11 65 35 3 117 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q1RJS1 8.95e-11 64 32 3 109 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P52940 1.09e-10 63 36 4 130 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P52941 1.12e-10 63 37 5 116 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q10WZ6 1.62e-10 63 40 6 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q5A4X5 1.93e-10 63 35 2 108 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
P45709 2.05e-10 59 36 4 117 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q9HWA4 2.19e-10 62 34 4 114 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9AAK0 2.45e-10 62 40 5 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P96126 2.62e-10 60 28 2 120 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
P39486 3.48e-10 61 36 6 104 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q8D4X6 3.89e-10 62 34 5 135 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q7MBQ5 4.1e-10 62 34 5 135 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
P52936 4.29e-10 61 36 4 121 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q04849 5.04e-10 62 35 4 118 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8KIY1 5.41e-10 62 31 3 117 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q4UL27 5.45e-10 62 33 3 109 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B0R4K1 5.57e-10 58 32 4 116 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q2KCH7 5.58e-10 58 36 5 121 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q30RX5 6.92e-10 61 30 4 135 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q92HC2 7.49e-10 61 33 3 109 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q51455 7.69e-10 58 34 3 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZCY9 8.63e-10 61 31 3 109 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
P52938 8.85e-10 60 36 3 119 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q9KM66 1.22e-09 61 32 2 116 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5JF95 1.9e-09 60 36 6 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q87GU5 1.9e-09 60 37 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q56312 2.42e-09 57 30 3 110 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P10577 2.75e-09 60 30 4 131 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P62640 2.79e-09 59 34 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q68WH4 3.19e-09 59 30 3 109 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q8L9Y3 3.25e-09 59 28 3 156 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q5A599 3.69e-09 60 30 2 130 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8D5Z6 3.89e-09 59 33 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q7MD16 4e-09 59 33 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q2WAJ8 4.14e-09 59 36 7 129 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q9I4N3 4.46e-09 59 37 3 113 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O58192 4.52e-09 59 31 5 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P10576 5.78e-09 58 29 5 150 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q88RJ6 6.14e-09 58 34 3 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1W0A5 6.66e-09 55 31 3 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 6.66e-09 55 31 3 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 6.66e-09 55 31 3 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q05943 6.82e-09 58 31 6 164 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P06628 7.27e-09 55 38 5 111 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P23747 7.77e-09 58 34 3 109 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5SML4 8.82e-09 58 27 3 139 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 8.82e-09 58 27 3 139 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
P40759 8.83e-09 58 28 2 119 3 glnL Transcriptional regulatory protein GlnL Bacillus subtilis (strain 168)
P42012 8.84e-09 57 34 4 117 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q67P67 8.92e-09 58 36 3 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P45671 9.48e-09 58 32 3 112 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P52942 1.19e-08 55 34 4 113 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q2RRX2 1.2e-08 57 37 4 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q88AQ2 1.24e-08 58 33 3 109 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P9WGM3 1.28e-08 56 32 4 119 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.28e-08 56 32 4 119 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9UYF3 1.46e-08 57 31 5 127 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
A2X1N2 2.13e-08 57 33 1 121 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
A7N6S2 2.2e-08 57 32 5 124 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q6H805 2.23e-08 57 33 1 121 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
Q3LWR6 2.3e-08 56 28 2 115 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 2.3e-08 56 28 2 115 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 2.3e-08 56 28 2 115 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9FXD6 2.6e-08 57 27 2 155 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P0A2D5 3.18e-08 53 32 3 120 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 3.18e-08 53 32 3 120 3 cheY Chemotaxis protein CheY Salmonella typhi
P38889 3.26e-08 57 32 3 132 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
E0X9C7 3.3e-08 57 31 3 113 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P24086 3.34e-08 54 27 4 121 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 3.34e-08 54 27 4 121 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P66797 3.99e-08 55 29 6 154 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 3.99e-08 55 29 6 154 3 uvrY Response regulator UvrY Escherichia coli O157:H7
P52939 4.21e-08 55 32 7 139 3 spo0A Stage 0 sporulation protein A homolog Clostridium innocuum
Q9FAD7 4.62e-08 53 32 3 120 3 cheY Chemotaxis protein CheY Enterobacter cloacae
P31802 5.12e-08 55 28 7 228 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P39928 5.17e-08 56 29 3 108 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P62646 5.85e-08 55 35 5 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q04848 6.33e-08 55 26 2 123 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P0A4H5 6.49e-08 53 35 4 117 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 6.49e-08 53 35 4 117 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P0AE69 6.77e-08 53 32 3 120 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 6.77e-08 53 32 3 120 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 6.77e-08 53 32 3 120 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P72253 6.92e-08 55 34 5 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
P54662 7.02e-08 55 24 10 239 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
P0AFU5 7.23e-08 55 37 3 118 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 7.23e-08 55 37 3 118 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q31HL9 7.31e-08 55 31 6 140 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P09432 7.75e-08 55 31 2 109 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O25153 8.49e-08 55 29 3 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q9RC52 8.91e-08 54 29 4 133 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8D0P1 9.33e-08 52 31 3 120 3 cheY Chemotaxis protein CheY Yersinia pestis
Q8FGP6 1.01e-07 52 32 3 120 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P62598 1.1e-07 55 32 4 131 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q2SFK0 1.1e-07 55 33 3 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q65JK6 1.12e-07 55 37 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q4UU85 1.13e-07 55 34 3 125 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
A5W4E3 1.13e-07 55 30 3 113 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q93P00 1.15e-07 52 31 3 120 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P0DMI2 1.24e-07 54 34 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.24e-07 54 34 4 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O49397 1.34e-07 55 33 3 118 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q8VL08 1.44e-07 54 36 5 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Azospirillum brasilense
Q940D0 1.55e-07 55 31 2 124 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P13632 1.56e-07 54 31 2 112 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P10046 1.57e-07 54 33 4 113 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P62637 1.6e-07 54 34 5 123 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AED6 1.78e-07 53 28 6 154 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 1.78e-07 53 28 6 154 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q9F8D7 1.79e-07 54 30 2 113 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q9KQD5 1.96e-07 52 33 3 120 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 1.96e-07 52 33 3 120 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q54SK5 2.07e-07 54 30 3 122 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q39T95 2.13e-07 54 32 4 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q5N6V8 2.14e-07 54 29 3 142 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q8EQQ3 2.16e-07 53 26 10 233 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A1SMR4 2.22e-07 54 38 7 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q311M8 2.25e-07 54 31 6 132 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P18769 2.27e-07 54 35 2 102 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q55169 2.3e-07 52 30 4 132 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q23917 2.35e-07 54 29 4 130 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
B8B3I4 2.36e-07 54 33 1 118 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q5SML5 2.41e-07 54 33 1 118 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
P39048 2.65e-07 53 30 2 115 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q05522 2.83e-07 53 33 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
P54302 2.87e-07 54 33 2 108 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
A2YQ93 2.91e-07 54 32 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q7NSI8 3.03e-07 53 32 4 136 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8PX96 3.1e-07 53 30 4 126 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1MP86 3.19e-07 53 29 7 154 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
Q0D3B6 3.41e-07 53 32 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
Q1D359 3.68e-07 53 35 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q88EW5 4.05e-07 53 33 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4L8V4 4.59e-07 52 32 6 145 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q3ADA6 4.65e-07 53 35 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q48GG6 4.96e-07 53 33 3 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8FFE0 5.07e-07 52 28 6 143 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q97GZ3 5.15e-07 53 31 5 147 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6K8X6 5.37e-07 53 32 1 118 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
B8AEH1 5.89e-07 53 32 1 118 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q4ZQV7 5.91e-07 52 33 3 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
P13800 6.47e-07 52 25 8 212 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
O52262 6.48e-07 52 33 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
O87125 6.72e-07 52 34 4 107 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HU19 6.82e-07 52 32 3 119 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q884V3 6.83e-07 52 33 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9ZWJ9 7.08e-07 53 28 2 132 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q9LYP5 7.12e-07 52 27 3 110 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
Q9SXL4 7.49e-07 53 25 2 155 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
Q3IDZ3 8.86e-07 52 31 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
Q9K998 9.38e-07 51 32 3 111 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5V0B3 1.05e-06 52 27 5 147 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q2ILG8 1.08e-06 52 37 2 102 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P15940 1.1e-06 51 28 3 135 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O14002 1.11e-06 52 31 3 119 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8ECD7 1.15e-06 52 30 4 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P48027 1.31e-06 52 31 2 113 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
D4GXP4 1.34e-06 52 35 2 112 3 HVO_1357 Putative transcriptional regulator HVO_1357 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q085K9 1.35e-06 52 28 5 144 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q1BRL2 1.35e-06 52 38 4 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q39KQ1 1.39e-06 51 38 4 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3KFZ6 1.41e-06 51 33 4 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
Q9M9B9 1.45e-06 52 23 1 117 2 ARR19 Putative two-component response regulator ARR19 Arabidopsis thaliana
Q4KG36 1.48e-06 51 33 4 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9KA55 1.91e-06 51 35 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1QI44 1.92e-06 51 32 4 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q52883 1.94e-06 51 32 5 132 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
P62638 1.95e-06 51 31 4 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5QZQ3 2.1e-06 51 34 6 117 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8H7S7 2.23e-06 51 30 4 127 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 2.27e-06 51 30 4 127 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
P0C5S5 2.29e-06 51 28 3 127 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 2.29e-06 51 28 3 127 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q8DB67 2.32e-06 51 30 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q7MIQ5 2.34e-06 51 30 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q87MX7 2.51e-06 51 28 3 127 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8KR08 2.67e-06 50 27 2 115 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P10958 2.75e-06 50 27 2 130 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q3SVA1 2.78e-06 50 31 4 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q0AWZ8 3.14e-06 50 29 8 165 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9I6V9 3.14e-06 50 39 4 105 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8FW53 3.42e-06 48 29 3 120 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 3.42e-06 48 29 3 120 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 3.42e-06 48 29 3 120 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 3.42e-06 48 29 3 120 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 3.42e-06 48 29 3 120 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 3.42e-06 48 29 3 120 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15820
Feature type CDS
Gene cpxR
Product envelope stress response regulator transcription factor CpxR
Location 3513754 - 3514452 (strand: -1)
Length 699 (nucleotides) / 232 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1772
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07662 two-component system, OmpR family, response regulator CpxR Cationic antimicrobial peptide (CAMP) resistance
Two-component system		 -

Protein Sequence

MHKILLVDDDRELTSLLKELLEMEGFNVVLATDGEQALKLLDASIDLLLLDIMMPRKNGIETLKELRQNFQTPVIMLTARGSDLDRVLGLELGADDYLPKPFNDRELVARIRAILRRSNWSEQKQTDGNTSPILQVDKLQLNPGRQEASFDNEPLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERTDGQPWFKTLRGRGYLMVSIT

Flanking regions ( +/- flanking 50bp)

ATAGATTCGCGCTATTTATTATCGTATTTTTCTCTTGGAGGAATTGACGAATGCATAAAATCTTATTAGTGGATGACGATCGCGAATTAACCTCGCTATTGAAAGAACTACTTGAAATGGAAGGCTTTAATGTTGTGCTCGCCACTGACGGCGAACAGGCCTTAAAACTTCTGGACGCGTCTATTGACTTGTTATTACTGGATATCATGATGCCACGTAAGAACGGGATCGAGACACTTAAAGAGTTACGCCAAAATTTCCAAACACCTGTCATTATGTTAACGGCAAGAGGCAGCGATCTTGATCGTGTACTTGGCCTAGAGCTGGGAGCAGATGACTATTTACCTAAGCCATTTAACGATAGAGAGCTAGTTGCACGCATTAGGGCTATTTTACGTCGTTCCAACTGGAGTGAACAGAAACAGACCGATGGCAACACCTCACCCATATTGCAAGTTGATAAGTTACAACTTAATCCGGGTAGACAAGAGGCCAGCTTTGATAATGAACCATTAGAGCTAACAGGTACTGAGTTTACGTTACTTTATCTACTTGCTCAGCATTTAGGACAAGTGGTATCGCGCGAGCATCTCAGCCAAGAAGTGTTAGGTAAACGCTTAACACCTTTTGATAGAGCGATTGATATGCATATTTCCAACTTACGTCGTAAGTTACCGGAAAGAACAGACGGGCAGCCTTGGTTTAAAACATTACGTGGCCGTGGTTATCTTATGGTTTCAATAACTTAATAAAAAATCTTTATGATAAACAGTTTGTCAGCGCGTATATTCGCCATATT