Homologs in group_1811

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12330 FBDBKF_12330 97.0 Morganella morganii S1 cpxR envelope stress response regulator transcription factor CpxR
EHELCC_13975 EHELCC_13975 97.0 Morganella morganii S2 cpxR envelope stress response regulator transcription factor CpxR
NLDBIP_15070 NLDBIP_15070 97.0 Morganella morganii S4 cpxR envelope stress response regulator transcription factor CpxR
LHKJJB_15540 LHKJJB_15540 97.0 Morganella morganii S3 cpxR envelope stress response regulator transcription factor CpxR
HKOGLL_14660 HKOGLL_14660 97.0 Morganella morganii S5 cpxR envelope stress response regulator transcription factor CpxR
PMI_RS15820 PMI_RS15820 90.9 Proteus mirabilis HI4320 cpxR envelope stress response regulator transcription factor CpxR

Distribution of the homologs in the orthogroup group_1811

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1811

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0A0H3GGB5 2.45e-134 380 86 1 233 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0AE90 5.94e-133 376 85 1 233 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 5.94e-133 376 85 1 233 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 5.94e-133 376 85 1 233 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P44895 2.93e-79 240 58 1 231 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37478 5.87e-57 184 41 2 229 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q7A216 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 4.92e-54 176 40 3 228 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 4.92e-54 176 40 3 228 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 4.92e-54 176 40 3 228 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 4.92e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4LAJ9 5.43e-54 176 40 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q8CQK0 1.35e-53 175 39 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.35e-53 175 39 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4A160 1.47e-52 172 39 2 228 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P13792 2.72e-52 172 41 4 231 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q8DPL7 8.27e-52 171 39 1 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 8.27e-52 171 39 1 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 8.27e-52 171 39 1 230 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0A4P7TS68 8.76e-48 160 40 3 230 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 8.76e-48 160 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 8.76e-48 160 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 8.76e-48 160 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 8.76e-48 160 40 3 230 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 8.76e-48 160 40 3 230 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 8.76e-48 160 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 8.76e-48 160 40 3 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
O78428 6.89e-47 158 42 4 232 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P48259 6.81e-46 155 41 4 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P51358 2.97e-45 154 39 4 232 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P28835 9.85e-45 152 39 3 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q06239 1.87e-44 151 37 4 232 3 vanR Regulatory protein VanR Enterococcus faecium
Q1XDC9 2.56e-44 151 39 5 233 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
A0PWB4 1.78e-43 149 39 5 230 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
A1TEL7 2.22e-43 149 39 5 230 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P28257 2.78e-43 149 39 4 232 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q742C1 3.87e-42 145 40 6 230 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.87e-42 145 40 6 230 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q9TLQ4 3.93e-42 146 38 3 234 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
A1KHB7 4.97e-42 145 39 5 230 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 4.97e-42 145 39 5 230 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P94413 9.22e-42 144 35 4 227 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P9WGM9 9.39e-42 144 39 5 230 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 9.39e-42 144 39 5 230 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 9.39e-42 144 39 5 230 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P69228 1.32e-41 144 38 3 227 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 1.32e-41 144 38 3 227 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45607 1.35e-41 144 38 5 230 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
A0R3I8 1.43e-41 144 39 6 230 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WGL9 2.02e-41 144 37 2 228 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 2.02e-41 144 37 2 228 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 2.02e-41 144 37 2 228 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1B3X8 4.24e-41 143 39 5 230 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 4.24e-41 143 39 5 230 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 4.24e-41 143 39 5 230 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P39663 7.28e-41 143 37 3 237 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
L7N689 7.52e-41 143 38 4 229 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0AFJ5 1.04e-40 142 38 5 230 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.04e-40 142 38 5 230 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 1.12e-40 142 38 5 230 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q9F868 1.37e-40 141 37 2 228 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CD68 1.39e-40 141 39 5 230 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P31079 2.52e-40 141 36 3 233 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P45605 3.06e-40 140 37 4 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
G3XCY6 3.94e-40 140 35 4 235 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C001 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 5.68e-40 139 36 5 231 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 5.68e-40 139 36 5 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P42244 5.92e-40 140 35 2 224 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q7A0U4 1.45e-39 139 35 3 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.45e-39 139 35 3 228 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.45e-39 139 35 3 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.45e-39 139 35 3 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.45e-39 139 35 3 228 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.45e-39 139 35 3 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.45e-39 139 35 3 228 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.45e-39 139 35 3 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P35163 4.33e-39 138 35 4 231 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q99U73 8.22e-39 136 37 6 231 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q49XM7 9.18e-39 136 37 5 231 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P54443 1.03e-38 137 34 2 226 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
O34903 1.91e-38 136 37 5 232 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P23620 3.4e-38 135 35 4 228 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4L6C6 3.66e-38 135 35 5 231 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q9HV32 5.69e-38 134 39 4 227 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P50350 9.03e-38 134 37 2 234 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q07783 2.46e-37 134 34 2 241 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q55890 4.48e-37 133 37 3 237 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q31S42 7.43e-37 132 37 3 231 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P44918 9.69e-37 132 34 2 226 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P94504 1.02e-36 132 32 4 229 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q49ZT8 1.58e-36 131 33 3 228 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q44929 1.93e-36 131 35 4 231 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P32040 5.13e-36 130 36 3 234 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
O32192 8.56e-36 129 36 4 232 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q9KM23 2.44e-35 128 38 5 229 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7D9K0 2.57e-35 129 37 4 227 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.57e-35 129 37 4 227 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9HUI2 7.25e-35 127 32 4 253 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q70FH0 1.24e-34 126 37 4 232 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q7A1J1 1.29e-34 126 32 2 228 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.29e-34 126 32 2 228 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.29e-34 126 32 2 228 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.29e-34 126 32 2 228 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.29e-34 126 32 2 228 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.29e-34 126 32 2 228 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.29e-34 126 32 2 228 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.29e-34 126 32 2 228 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.29e-34 126 32 2 228 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.29e-34 126 32 2 228 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q2YZ24 1.81e-34 125 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A6QJK3 2.24e-34 125 33 4 228 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 2.24e-34 125 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P45189 2.49e-34 125 33 5 233 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P50351 2.5e-34 125 35 2 235 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7A039 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 4.35e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE73 4.94e-34 124 33 4 228 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
P08368 4.94e-34 124 35 4 229 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P54884 7.66e-34 123 38 2 196 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q9I0I1 8.49e-34 124 37 4 227 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DMK7 1.05e-33 124 35 3 228 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 1.05e-33 124 35 3 228 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q8CQ17 4.87e-33 122 31 4 229 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 4.87e-33 122 31 4 229 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8FZ93 4.93e-33 122 33 3 229 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 4.93e-33 122 33 3 229 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 4.93e-33 122 33 3 229 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 4.93e-33 122 33 3 229 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 4.93e-33 122 33 3 229 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 4.93e-33 122 33 3 229 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 4.93e-33 122 33 3 229 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 4.93e-33 122 33 3 229 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q8DN02 7.74e-33 121 35 7 233 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 7.74e-33 121 35 7 233 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q04803 1.42e-32 123 36 3 232 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6WZ81 1.51e-32 121 32 3 229 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P76340 1.61e-32 120 35 4 234 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q52990 1.84e-32 120 36 5 236 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q5HLN2 2.61e-32 120 31 3 228 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P9WGM1 2.82e-32 120 39 6 216 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 2.82e-32 120 39 6 216 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 2.82e-32 120 39 6 216 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0A9Q4 5.49e-32 119 32 3 226 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 5.49e-32 119 32 3 226 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 5.49e-32 119 32 3 226 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 5.49e-32 119 32 3 226 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q8CN92 8.19e-32 119 31 3 228 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9ZEP4 9.74e-32 119 34 3 231 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P52076 1.21e-31 118 35 4 229 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q9AE24 1.34e-31 119 32 4 231 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q44006 1.81e-31 118 33 3 228 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q50136 1.98e-31 118 39 6 216 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P30843 2.17e-31 117 36 5 233 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q82EB1 2.27e-31 118 34 3 232 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5HPC3 2.71e-31 117 34 4 235 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P9WGM7 2.74e-31 117 35 3 227 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 2.74e-31 117 35 3 227 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 2.74e-31 117 35 3 227 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 2.83e-31 117 35 3 227 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8CP82 4.25e-31 117 34 4 235 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A0QTK2 7.24e-31 116 33 2 227 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q47456 7.35e-31 116 35 6 232 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q9CCJ2 8.78e-31 116 35 3 227 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q8XBS3 1.26e-30 115 35 4 229 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q04942 3.15e-30 114 36 4 228 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P66795 3.19e-30 114 35 4 232 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 3.19e-30 114 35 4 232 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q4L8L9 4.32e-30 114 31 3 232 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q01473 4.56e-30 120 34 4 235 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 2.26e-09 60 32 3 125 3 rcaC Protein RcaC Microchaete diplosiphon
Q02540 7.59e-30 114 34 4 229 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P52108 8.35e-30 114 30 2 234 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
P42421 8.49e-30 114 30 4 230 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P36556 1.01e-29 113 36 5 234 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2FWH6 1.14e-29 113 33 4 231 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P0A4I0 1.16e-29 113 33 3 209 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.16e-29 113 33 3 209 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
B8H358 1.57e-29 113 32 4 230 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.57e-29 113 32 4 230 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0A4H8 1.74e-29 112 34 5 231 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.74e-29 112 34 5 231 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q47744 2.5e-29 112 33 3 226 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q9I4F9 1.17e-28 110 34 4 229 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0CL17 2.65e-28 109 38 9 235 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 2.65e-28 109 38 9 235 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q07597 5.46e-28 109 31 6 235 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
P45337 5.59e-28 108 33 6 234 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38684 6.22e-28 108 31 4 232 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
Q9ZHD3 6.39e-28 108 36 5 231 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P0ACZ8 1.8e-27 107 35 6 231 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.8e-27 107 35 6 231 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.8e-27 107 35 6 231 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P9WGN1 2.04e-27 107 32 4 229 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.04e-27 107 32 4 229 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4I2 3.09e-27 107 33 4 227 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 3.09e-27 107 33 4 227 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P58357 7.74e-27 106 30 4 232 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
O69730 2.49e-26 105 34 5 231 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P23836 2.78e-26 104 31 5 233 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
O06978 7.33e-26 103 30 3 228 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q83RR0 7.35e-26 103 30 5 233 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 7.35e-26 103 30 5 233 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8GP20 1.61e-25 102 33 5 230 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P21866 2.26e-25 102 30 2 228 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q55933 2.28e-25 102 33 5 235 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8X738 2.3e-25 102 30 5 233 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q8Z7H2 4.3e-25 101 30 4 231 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
O24973 5.78e-25 101 32 3 228 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
P0DM78 7.36e-25 100 30 4 231 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 7.36e-25 100 30 4 231 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 7.36e-25 100 30 4 231 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 7.36e-25 100 30 4 231 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 7.36e-25 100 30 4 231 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P33112 1.23e-24 100 32 3 227 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q932F1 1.29e-24 100 28 4 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8CQ37 1.36e-24 100 28 4 228 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.36e-24 100 28 4 228 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P13359 1.75e-24 100 32 6 233 3 virG Regulatory protein VirG Rhizobium rhizogenes
Q57QC3 2.81e-24 99 30 4 231 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q9K621 3.34e-24 99 29 6 233 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8Z181 3.39e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 3.39e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 3.39e-24 99 28 4 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 3.39e-24 99 28 4 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 3.39e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q7A1L2 4.37e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 4.37e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 4.37e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 4.37e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 4.37e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 4.37e-24 99 28 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1XDE4 6.79e-24 98 38 7 184 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q6GJ11 1.1e-23 97 27 5 229 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q2YSS2 1.14e-23 97 27 4 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L481 1.68e-23 97 27 5 229 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q49VK3 4.78e-22 93 28 5 228 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P07545 9.63e-22 93 32 5 232 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P62722 1.38e-21 93 32 6 233 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q44444 6.98e-21 91 32 6 233 3 virG Regulatory protein VirG Rhizobium radiobacter
O31432 4.72e-19 85 27 8 226 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
O34951 8.67e-19 85 27 4 229 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P46384 2.89e-17 78 38 3 115 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O25918 3.52e-16 77 28 6 228 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P55701 3.95e-16 77 30 7 230 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P48359 4.09e-16 77 33 3 162 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P52931 1.45e-15 75 36 5 141 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P72781 1.46e-15 76 37 5 135 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8GZM2 3.67e-15 77 40 2 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
B8GZM2 0.000388 44 23 2 142 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 3.67e-15 77 40 2 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A5I5 0.000388 44 23 2 142 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
T2KMF4 5.6e-15 77 37 3 116 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P43501 9.85e-15 71 35 2 119 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06065 2.03e-14 75 40 2 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P51343 2.72e-14 72 35 5 168 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
P52929 3.13e-14 72 37 4 119 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P52934 1.41e-13 71 37 4 124 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
P06534 1.76e-13 71 39 4 120 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P41789 2.68e-13 72 41 6 126 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFB8 2.68e-13 72 41 6 126 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.68e-13 72 41 6 126 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P14375 2.96e-13 71 38 2 118 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q1IRH0 3.18e-13 71 30 9 209 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q8Z333 3.97e-13 71 41 2 102 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q8X613 4.36e-13 71 38 2 118 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P25852 4.57e-13 71 41 2 102 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9APD9 4.81e-13 71 38 2 127 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P52932 5.38e-13 68 38 4 120 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
P03029 6.45e-13 70 41 6 124 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P0A4I4 1.3e-12 68 36 5 125 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.3e-12 68 36 5 125 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P52928 1.69e-12 68 35 4 127 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P40138 2.24e-12 68 31 3 148 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q54SP4 2.47e-12 69 38 4 115 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 4.58e-06 50 32 3 129 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P24072 2.52e-12 65 38 4 112 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
P52941 4.83e-12 67 37 4 116 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P28787 5.06e-12 68 35 6 149 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P23221 9.58e-12 65 33 2 124 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q54YZ9 9.71e-12 67 35 3 139 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P96686 1.07e-11 65 34 2 119 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q9KSB1 1.72e-11 66 36 4 130 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P96602 1.76e-11 65 34 6 138 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P58253 2.33e-11 65 35 7 160 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q86AT9 2.38e-11 66 36 3 116 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P51586 3.82e-11 62 37 2 109 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9WY30 5.51e-11 64 32 2 114 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0AEV3 8.59e-11 64 38 3 112 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 8.59e-11 64 38 3 112 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 8.59e-11 64 38 3 112 3 rssB Regulator of RpoS Escherichia coli O157:H7
P52936 9.23e-11 63 36 6 136 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
O05251 1.59e-10 62 44 6 107 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P52940 2.44e-10 62 37 4 121 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q8D4X6 3.34e-10 62 29 7 215 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q10WZ6 3.4e-10 62 40 6 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q7MBQ5 3.61e-10 62 29 7 215 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
P26487 4.84e-10 60 32 3 128 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P52938 5.23e-10 61 36 4 119 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
P45709 5.37e-10 58 37 5 119 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q5A599 5.66e-10 62 30 5 173 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P71403 7.96e-10 58 29 3 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P39486 9.36e-10 60 36 7 112 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q5A4X5 9.82e-10 61 34 2 108 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8L9Y3 1.04e-09 61 31 4 147 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q9ZM64 1.3e-09 57 29 3 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
D4GXP4 1.63e-09 60 38 2 101 3 HVO_1357 Putative transcriptional regulator HVO_1357 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q1RJS1 1.95e-09 60 30 3 109 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q9ZCY9 1.98e-09 60 32 3 109 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q30RX5 2.12e-09 60 28 4 145 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q9HWA4 2.24e-09 59 33 4 114 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O58192 2.4e-09 60 32 6 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8KIY1 2.48e-09 60 30 3 117 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
B0R4K1 2.82e-09 56 31 4 117 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q2KCH7 3.6e-09 56 35 5 121 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P10576 3.68e-09 59 27 4 151 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P06628 3.93e-09 56 39 5 110 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q2WAJ8 4.33e-09 59 35 7 129 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q51455 5.27e-09 56 33 3 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2RRX2 5.66e-09 58 36 4 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9UYF3 5.91e-09 58 32 6 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q5JF95 6.01e-09 58 35 6 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9I4N3 6.65e-09 58 37 3 113 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52942 6.71e-09 55 35 4 114 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q87GU5 7.33e-09 58 36 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4UL27 7.59e-09 58 31 3 109 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q5SML4 7.74e-09 58 26 2 136 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 7.74e-09 58 26 2 136 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
Q04849 8.39e-09 58 34 4 118 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q92HC2 9.57e-09 58 31 3 109 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q68WH4 1.03e-08 58 30 3 109 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9AAK0 1.12e-08 58 39 5 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9HU19 1.16e-08 58 34 2 116 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1W0A5 1.16e-08 55 29 3 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.16e-08 55 29 3 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.16e-08 55 29 3 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P23747 2.1e-08 57 33 3 110 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45671 2.19e-08 57 30 3 130 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
A7N6S2 2.3e-08 57 32 5 124 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q7MD16 2.39e-08 57 32 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q8D5Z6 2.43e-08 57 32 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
P96126 2.58e-08 54 27 2 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q88RJ6 2.96e-08 57 32 3 110 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9FXD6 3.13e-08 57 29 1 118 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q05943 3.33e-08 56 31 5 164 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
E0X9C7 3.51e-08 57 31 3 113 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
A2X1N2 3.52e-08 57 32 1 121 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q6H805 3.58e-08 57 32 1 121 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
P09432 3.67e-08 56 31 3 114 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q88AQ2 3.84e-08 56 32 3 110 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P9WGM3 4.3e-08 55 32 4 119 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 4.3e-08 55 32 4 119 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P40759 4.63e-08 55 27 2 119 3 glnL Transcriptional regulatory protein GlnL Bacillus subtilis (strain 168)
Q55169 5.16e-08 53 31 4 132 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P39928 5.67e-08 56 28 3 108 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P10577 6.04e-08 56 30 2 110 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q9KM66 6.66e-08 56 31 2 116 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5V0B3 8.19e-08 55 28 4 144 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P42012 8.59e-08 55 33 3 115 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
A2YQ93 9.13e-08 55 32 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q0D3B6 9.56e-08 55 32 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
P0DMI2 1.12e-07 55 34 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.12e-07 55 34 4 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q3LWR6 1.14e-07 54 29 2 115 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 1.14e-07 54 29 2 115 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 1.14e-07 54 29 2 115 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5W4E3 1.29e-07 55 30 3 113 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q56312 1.31e-07 52 28 3 110 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q04848 1.43e-07 55 26 2 124 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8VL08 1.52e-07 54 37 5 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Azospirillum brasilense
P62646 1.52e-07 54 35 5 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P62637 1.54e-07 54 35 5 123 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P10046 1.62e-07 54 33 4 113 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q9F8D7 1.74e-07 55 30 2 113 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P0AFU5 1.98e-07 54 36 3 118 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 1.98e-07 54 36 3 118 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q65JK6 2.03e-07 54 37 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P15940 2.26e-07 53 29 2 124 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q311M8 2.37e-07 53 31 6 132 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P31802 2.62e-07 53 27 6 229 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q9LYP5 2.87e-07 54 27 3 109 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
P62598 3.39e-07 53 33 3 118 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
O49397 3.47e-07 53 33 3 118 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P62640 3.51e-07 53 32 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P0A2D5 3.76e-07 51 31 3 120 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 3.76e-07 51 31 3 120 3 cheY Chemotaxis protein CheY Salmonella typhi
Q2ILG8 4.1e-07 53 29 5 182 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
A1SMR4 4.35e-07 53 28 8 164 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P13632 4.68e-07 53 31 2 111 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P38889 4.7e-07 53 32 3 124 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q940D0 4.79e-07 53 30 2 124 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
Q9FAD7 4.97e-07 50 31 3 120 3 cheY Chemotaxis protein CheY Enterobacter cloacae
P18769 5.02e-07 53 34 2 102 1 frzE Gliding motility regulatory protein Myxococcus xanthus
P0A4H5 5.19e-07 50 34 4 117 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 5.19e-07 50 34 4 117 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P24086 5.5e-07 50 25 4 120 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 5.5e-07 50 25 4 120 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q3SIG0 5.54e-07 53 38 5 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
P48027 5.89e-07 53 31 2 113 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q1BRL2 5.9e-07 52 35 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
P72253 5.95e-07 53 33 5 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
P0AE69 6.25e-07 50 31 3 120 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 6.25e-07 50 31 3 120 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 6.25e-07 50 31 3 120 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q9LZJ8 6.55e-07 52 27 2 119 2 ARR20 Putative two-component response regulator ARR20 Arabidopsis thaliana
Q67P67 6.94e-07 52 34 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1MP86 7.27e-07 52 30 6 136 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
Q1D359 8.08e-07 52 26 5 189 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q54SK5 8.17e-07 53 30 3 122 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q9KQD5 8.17e-07 50 32 3 120 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 8.17e-07 50 32 3 120 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q31HL9 8.63e-07 52 32 6 138 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5SML5 9e-07 52 30 1 127 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 9e-07 52 30 1 127 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q8FGP6 9.5e-07 50 31 3 120 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q54RP6 9.67e-07 52 27 3 129 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
Q05522 9.96e-07 52 34 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q7Y0W5 1e-06 52 25 1 131 1 EHD1 Two-component response regulator ORR30 Oryza sativa subsp. japonica
Q9I6V9 1.03e-06 52 40 4 105 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7Y0W3 1.04e-06 52 25 1 131 2 EHD1 Two-component response regulator EHD1 Oryza sativa subsp. indica
Q4UU85 1.09e-06 52 32 3 125 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q39KQ1 1.13e-06 52 35 3 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8PX96 1.14e-06 52 30 4 126 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P54662 1.2e-06 51 24 7 214 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q8NYH3 1.2e-06 51 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 1.2e-06 51 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q8XQ83 1.23e-06 52 39 5 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q085K9 1.28e-06 52 28 5 144 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q2SFK0 1.3e-06 52 33 3 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q6GK51 1.35e-06 51 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q93P00 1.36e-06 49 30 3 120 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
O87125 1.37e-06 52 34 3 110 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D0P1 1.4e-06 49 30 3 120 3 cheY Chemotaxis protein CheY Yersinia pestis
Q7NSI8 1.44e-06 51 32 6 140 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6AJV3 1.45e-06 51 40 5 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q48GG6 1.47e-06 51 35 4 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B8AEH1 1.7e-06 52 31 1 118 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q4ZQV7 1.72e-06 51 35 4 110 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q6K8X6 1.73e-06 52 31 1 118 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
Q884V3 1.75e-06 51 35 4 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P60610 1.78e-06 50 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 1.78e-06 50 31 6 138 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 1.78e-06 50 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 1.78e-06 50 31 6 138 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 1.78e-06 50 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
P10958 1.89e-06 50 30 3 127 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
Q6GK93 2.01e-06 50 31 4 130 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q2YV56 2.04e-06 50 31 4 130 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7N5T1 2.08e-06 51 39 6 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8KR08 2.11e-06 50 28 4 128 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q23917 2.17e-06 51 28 4 132 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
Q9HV27 2.19e-06 51 37 2 96 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8NYJ9 2.23e-06 50 31 4 130 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 2.23e-06 50 31 4 130 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 2.23e-06 50 31 4 130 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 2.23e-06 50 31 4 130 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 2.23e-06 50 31 4 130 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q63PS2 2.25e-06 51 39 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
Q2YV67 2.27e-06 50 31 6 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q39T95 2.31e-06 51 31 4 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9SXL4 2.52e-06 51 33 1 78 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
P54302 2.55e-06 51 32 2 108 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
Q3JY65 2.62e-06 50 39 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 2.62e-06 50 39 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q2STS8 2.69e-06 50 39 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9RC52 2.79e-06 50 28 5 132 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O25153 2.86e-06 51 27 3 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q221I1 3.17e-06 50 39 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2LR65 3.22e-06 50 24 9 202 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q8H7S7 3.33e-06 50 28 3 132 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
P52939 3.53e-06 50 34 5 117 3 spo0A Stage 0 sporulation protein A homolog Clostridium innocuum
A2XE31 3.55e-06 50 28 3 132 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q8EQQ3 3.58e-06 50 26 10 233 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q13SY2 3.85e-06 50 34 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q4L8V4 4.16e-06 50 36 5 106 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q3SVA1 4.19e-06 50 28 7 157 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q88EW5 4.24e-06 50 34 4 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9ZWJ9 4.42e-06 50 29 2 124 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
P0AED6 4.81e-06 49 27 6 157 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 4.81e-06 49 27 6 157 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q87MX7 4.82e-06 50 24 2 129 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17160
Feature type CDS
Gene cpxR
Product envelope stress response regulator transcription factor CpxR
Location 63901 - 64602 (strand: 1)
Length 702 (nucleotides) / 233 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1811
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07662 two-component system, OmpR family, response regulator CpxR Cationic antimicrobial peptide (CAMP) resistance
Two-component system
-

Protein Sequence

MNKILLVDDDRELTSLLKELLDMEGFNVVIAHDGEQALALIDDSIDLLLLDIMMPRKNGIETLKELRQNFQTPVIMLTARGSDLDRVLGLELGADDYLPKPFNDRELVARIRAILRRSNWSEQQQNDTGSNSSVVMVDKLQLNPGRQEASFADEVLDLTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERTDGLPWFKTLRGRGYLMVSAT

Flanking regions ( +/- flanking 50bp)

ATGGAATAGAAACGTTTGTTGTCGTATTTTGCTCGTGGAGGACGTAAATAATGAATAAGATACTGCTTGTTGATGATGACCGCGAATTAACGTCGCTGTTAAAAGAGTTACTCGATATGGAAGGGTTCAACGTTGTCATTGCACATGACGGCGAGCAGGCTCTGGCCCTGATTGATGATTCCATAGATCTGTTATTGCTCGATATTATGATGCCGCGTAAAAACGGTATTGAAACTCTGAAAGAGTTACGCCAGAATTTCCAGACGCCGGTGATTATGCTGACCGCACGCGGCAGTGATTTAGACCGCGTTCTGGGGCTTGAACTGGGCGCAGATGACTATCTGCCGAAACCGTTTAACGACCGGGAGCTTGTCGCCCGTATCCGCGCAATCCTGCGCCGCTCCAACTGGAGTGAACAACAGCAGAATGATACCGGCAGCAACTCATCTGTTGTCATGGTTGATAAACTGCAACTCAACCCGGGACGCCAGGAAGCAAGCTTTGCTGATGAAGTGCTCGACCTGACCGGTACCGAGTTCACCCTGCTCTATCTGCTCGCACAGCATCTGGGACAGGTTGTCAGCCGTGAACACCTCAGCCAGGAAGTACTGGGCAAGCGCCTGACCCCGTTTGACCGCGCAATTGACATGCACATCTCCAACCTGCGCCGTAAATTACCGGAGCGCACCGACGGGCTGCCGTGGTTTAAAACCTTACGCGGACGCGGCTATCTGATGGTATCGGCAACATGATAAGCAGCCTGACTGCGAGGATTTTCGCGATTTTCTGGTTCACCCTCGCA